BLASTX nr result
ID: Paeonia25_contig00036431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00036431 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235686.1| PREDICTED: uncharacterized protein LOC101267... 67 3e-09 ref|XP_004141838.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006465641.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006426928.1| hypothetical protein CICLE_v10026419mg [Citr... 62 6e-08 ref|XP_004305281.1| PREDICTED: uncharacterized protein LOC101315... 62 1e-07 ref|XP_003632859.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_007215942.1| hypothetical protein PRUPE_ppa011224mg [Prun... 56 5e-06 ref|XP_002304213.2| hypothetical protein POPTR_0003s04990g [Popu... 55 8e-06 >ref|XP_004235686.1| PREDICTED: uncharacterized protein LOC101267975 [Solanum lycopersicum] Length = 228 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/52 (53%), Positives = 42/52 (80%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEIDKKIEKDA 157 STV+VY LMK+SGWG +ID+YVAKVL RG +R G++ ADE+D+++++ + Sbjct: 174 STVRVYELMKKSGWGSRFEIDEYVAKVLRRGFKRFGKEEMADEVDQQLQRSS 225 >ref|XP_004141838.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] gi|449491766|ref|XP_004158997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] Length = 230 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEIDKKIE 166 STV++Y +M+R GWG K DDY+ KVLS+GLRRLGE ADEI+++ E Sbjct: 176 STVRIYRMMRRKGWGSMIKADDYMIKVLSKGLRRLGEIELADEINREFE 224 >ref|XP_006465641.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Citrus sinensis] Length = 318 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEIDKK 172 STV++YGLMKRSG G + K+D+YV KVLS+GLRR GE+ A+E++++ Sbjct: 258 STVRIYGLMKRSGVGCSWKVDEYVGKVLSKGLRRFGEEELANEVERE 304 >ref|XP_006426928.1| hypothetical protein CICLE_v10026419mg [Citrus clementina] gi|557528918|gb|ESR40168.1| hypothetical protein CICLE_v10026419mg [Citrus clementina] Length = 229 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/47 (57%), Positives = 39/47 (82%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEIDKK 172 STV++YGLMKRSG G + K+D+Y KVLS+GLRR GE+ A+E++++ Sbjct: 169 STVRIYGLMKRSGVGCSWKVDEYAGKVLSKGLRRFGEEELANEVERE 215 >ref|XP_004305281.1| PREDICTED: uncharacterized protein LOC101315171 [Fragaria vesca subsp. vesca] Length = 229 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTC-KIDDYVAKVLSRGLRRLGEKSAADEIDKK 172 STV++Y ++KR+GWG + K D+Y+ KVLS+GLRRLGE ADE+D K Sbjct: 173 STVRIYEMLKRNGWGTSSFKADEYMVKVLSKGLRRLGEAQLADEVDAK 220 >ref|XP_003632859.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Vitis vinifera] gi|297743240|emb|CBI36107.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEID 178 STV++YGLMKRSG G D+YV +VLSRGLRRLGE ADE+D Sbjct: 173 STVRIYGLMKRSGCGGG---DEYVGRVLSRGLRRLGELGVADEVD 214 >ref|XP_007215942.1| hypothetical protein PRUPE_ppa011224mg [Prunus persica] gi|462412092|gb|EMJ17141.1| hypothetical protein PRUPE_ppa011224mg [Prunus persica] Length = 219 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/44 (59%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDT-CKIDDYVAKVLSRGLRRLGEKSAADE 184 STVK+Y ++KR+GWG + K D+Y+ +VLS+GLRRLGE ADE Sbjct: 172 STVKIYEMLKRNGWGSSDFKADEYMVRVLSKGLRRLGEVGLADE 215 >ref|XP_002304213.2| hypothetical protein POPTR_0003s04990g [Populus trichocarpa] gi|550342433|gb|EEE79192.2| hypothetical protein POPTR_0003s04990g [Populus trichocarpa] Length = 238 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = -2 Query: 312 STVKVYGLMKRSGWGDTCKIDDYVAKVLSRGLRRLGEKSAADEIDKK 172 STV++ G+++RSG GDT D+YV KVL RGL+ +GE A E+D++ Sbjct: 178 STVRICGMLRRSGCGDTWTTDEYVVKVLRRGLKEMGEIEMASEVDRE 224