BLASTX nr result
ID: Paeonia25_contig00035456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035456 (568 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40973.3| unnamed protein product [Vitis vinifera] 58 2e-06 emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] 57 3e-06 >emb|CBI40973.3| unnamed protein product [Vitis vinifera] Length = 801 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 91 LIKEALMHFSLWKPISHCAALIMDKKSRRK 2 L +EALMH SLWKPISHCA+LIMDKKSRRK Sbjct: 15 LSREALMHLSLWKPISHCASLIMDKKSRRK 44 >emb|CAN75833.1| hypothetical protein VITISV_039637 [Vitis vinifera] Length = 1281 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 85 KEALMHFSLWKPISHCAALIMDKKSRRK 2 +EALMH SLWKPISHCA+LIMDKKSRRK Sbjct: 340 REALMHLSLWKPISHCASLIMDKKSRRK 367