BLASTX nr result
ID: Paeonia25_contig00035416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035416 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632499.1| PREDICTED: uncharacterized protein LOC100854... 64 3e-08 emb|CAN65326.1| hypothetical protein VITISV_018102 [Vitis vinifera] 64 3e-08 ref|XP_002525277.1| beta-glucanase, putative [Ricinus communis] ... 58 2e-06 >ref|XP_003632499.1| PREDICTED: uncharacterized protein LOC100854050 [Vitis vinifera] Length = 492 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 397 LGDKKEEIMRMRNKYRKPTTFRCNAGSRCSL 489 LGDK EE MRMRNKYRKPTTFRCNAGSRCSL Sbjct: 16 LGDKLEEKMRMRNKYRKPTTFRCNAGSRCSL 46 >emb|CAN65326.1| hypothetical protein VITISV_018102 [Vitis vinifera] Length = 738 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +1 Query: 397 LGDKKEEIMRMRNKYRKPTTFRCNAGSRCSL 489 LGDK EE MRMRNKYRKPTTFRCNAGSRCSL Sbjct: 517 LGDKLEEKMRMRNKYRKPTTFRCNAGSRCSL 547 >ref|XP_002525277.1| beta-glucanase, putative [Ricinus communis] gi|223535435|gb|EEF37105.1| beta-glucanase, putative [Ricinus communis] Length = 499 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 2/36 (5%) Frame = +1 Query: 388 QHYLGDKKE--EIMRMRNKYRKPTTFRCNAGSRCSL 489 QHYLGDKK+ E MR+RNKYRK TTF CNAG RCS+ Sbjct: 19 QHYLGDKKKRSEKMRIRNKYRKSTTFPCNAGGRCSM 54