BLASTX nr result
ID: Paeonia25_contig00035349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035349 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515726.1| conserved hypothetical protein [Ricinus comm... 181 1e-43 ref|XP_007051955.1| EXS (ERD1/XPR1/SYG1) family protein isoform ... 177 1e-42 ref|XP_007051954.1| EXS (ERD1/XPR1/SYG1) family protein isoform ... 177 1e-42 ref|XP_006592823.1| PREDICTED: SPX and EXS domain-containing pro... 171 1e-40 ref|XP_007149954.1| hypothetical protein PHAVU_005G113400g [Phas... 171 1e-40 ref|XP_004487374.1| PREDICTED: SPX and EXS domain-containing pro... 171 1e-40 ref|XP_006592822.1| PREDICTED: SPX and EXS domain-containing pro... 171 1e-40 gb|EYU45123.1| hypothetical protein MIMGU_mgv1a005760mg [Mimulus... 171 1e-40 ref|XP_006359989.1| PREDICTED: SPX and EXS domain-containing pro... 171 1e-40 ref|XP_002310465.2| hypothetical protein POPTR_0007s02660g [Popu... 171 1e-40 ref|XP_006854429.1| hypothetical protein AMTR_s00039p00211610 [A... 171 1e-40 ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing pro... 171 1e-40 ref|XP_006469721.1| PREDICTED: SPX and EXS domain-containing pro... 170 2e-40 ref|XP_006447490.1| hypothetical protein CICLE_v10015128mg [Citr... 170 2e-40 ref|XP_006447489.1| hypothetical protein CICLE_v10015128mg [Citr... 170 2e-40 ref|XP_006447488.1| hypothetical protein CICLE_v10015128mg [Citr... 170 2e-40 ref|XP_004243116.1| PREDICTED: SPX and EXS domain-containing pro... 170 2e-40 ref|XP_006367309.1| PREDICTED: SPX and EXS domain-containing pro... 170 2e-40 ref|XP_004238236.1| PREDICTED: SPX and EXS domain-containing pro... 170 2e-40 ref|XP_006594887.1| PREDICTED: SPX and EXS domain-containing pro... 169 3e-40 >ref|XP_002515726.1| conserved hypothetical protein [Ricinus communis] gi|223545163|gb|EEF46673.1| conserved hypothetical protein [Ricinus communis] Length = 473 Score = 181 bits (458), Expect = 1e-43 Identities = 78/87 (89%), Positives = 86/87 (98%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLS FTR+FKFNKPN+CS++LYGRKWVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 358 VTRDWDLSCFTRVFKFNKPNVCSYILYGRKWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ALE++RRFQWVFFRVENEWNK Sbjct: 418 TVFAITALEMVRRFQWVFFRVENEWNK 444 >ref|XP_007051955.1| EXS (ERD1/XPR1/SYG1) family protein isoform 2 [Theobroma cacao] gi|508704216|gb|EOX96112.1| EXS (ERD1/XPR1/SYG1) family protein isoform 2 [Theobroma cacao] Length = 474 Score = 177 bits (450), Expect = 1e-42 Identities = 77/87 (88%), Positives = 85/87 (97%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLSVFTRIFKFNKP+ CS+LLYGR+WVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 360 VTRDWDLSVFTRIFKFNKPSYCSNLLYGRQWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 419 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF ++ALE+LRRFQW+FFRVENEWNK Sbjct: 420 TVFMVTALEMLRRFQWIFFRVENEWNK 446 >ref|XP_007051954.1| EXS (ERD1/XPR1/SYG1) family protein isoform 1 [Theobroma cacao] gi|590722653|ref|XP_007051956.1| EXS (ERD1/XPR1/SYG1) family protein isoform 1 [Theobroma cacao] gi|508704215|gb|EOX96111.1| EXS (ERD1/XPR1/SYG1) family protein isoform 1 [Theobroma cacao] gi|508704217|gb|EOX96113.1| EXS (ERD1/XPR1/SYG1) family protein isoform 1 [Theobroma cacao] Length = 473 Score = 177 bits (450), Expect = 1e-42 Identities = 77/87 (88%), Positives = 85/87 (97%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLSVFTRIFKFNKP+ CS+LLYGR+WVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 359 VTRDWDLSVFTRIFKFNKPSYCSNLLYGRQWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 418 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF ++ALE+LRRFQW+FFRVENEWNK Sbjct: 419 TVFMVTALEMLRRFQWIFFRVENEWNK 445 >ref|XP_006592823.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Glycine max] Length = 436 Score = 171 bits (433), Expect = 1e-40 Identities = 76/87 (87%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 V RDWDLS FTRIFKFNKP+L SH+L+GR+WVYFWVIGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 321 VNRDWDLSGFTRIFKFNKPHLFSHMLHGRRWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 380 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQW+FFRVENEWNK Sbjct: 381 TVFFIAALEIFRRFQWIFFRVENEWNK 407 >ref|XP_007149954.1| hypothetical protein PHAVU_005G113400g [Phaseolus vulgaris] gi|561023218|gb|ESW21948.1| hypothetical protein PHAVU_005G113400g [Phaseolus vulgaris] Length = 472 Score = 171 bits (433), Expect = 1e-40 Identities = 75/87 (86%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 V RDWDLS FTRIFKFNKP+L SH+L+GR+WVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 357 VNRDWDLSGFTRIFKFNKPHLFSHMLHGRRWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 416 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQW+FFRVENEWNK Sbjct: 417 TVFIIAALEIFRRFQWIFFRVENEWNK 443 >ref|XP_004487374.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cicer arietinum] Length = 472 Score = 171 bits (433), Expect = 1e-40 Identities = 76/87 (87%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLS FTRIFKFNKPNL S++L+GR+WVY WVIGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 357 VTRDWDLSGFTRIFKFNKPNLFSYMLHGRRWVYIWVIGSNLVLRCTWTYKLSAHLRHNYL 416 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQW+FFRVENEWNK Sbjct: 417 TVFTIAALEIFRRFQWIFFRVENEWNK 443 >ref|XP_006592822.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Glycine max] Length = 472 Score = 171 bits (433), Expect = 1e-40 Identities = 76/87 (87%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 V RDWDLS FTRIFKFNKP+L SH+L+GR+WVYFWVIGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 357 VNRDWDLSGFTRIFKFNKPHLFSHMLHGRRWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 416 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQW+FFRVENEWNK Sbjct: 417 TVFFIAALEIFRRFQWIFFRVENEWNK 443 >gb|EYU45123.1| hypothetical protein MIMGU_mgv1a005760mg [Mimulus guttatus] Length = 471 Score = 171 bits (432), Expect = 1e-40 Identities = 72/87 (82%), Positives = 83/87 (95%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKF KP++ +H+LYGRKWVY WV+GSNL+LRCTWTYKLSAHLRHNY+ Sbjct: 358 ITRDWDLSCFTRIFKFTKPHILTHILYGRKWVYLWVVGSNLILRCTWTYKLSAHLRHNYI 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 T+FAI+ALE+LRRFQWVFFRVENEWNK Sbjct: 418 TLFAITALEMLRRFQWVFFRVENEWNK 444 >ref|XP_006359989.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Solanum tuberosum] Length = 470 Score = 171 bits (432), Expect = 1e-40 Identities = 74/87 (85%), Positives = 81/87 (93%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FT +FKFNKP++ SH LYGRKWVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 351 LTRDWDLSCFTLVFKFNKPHILSHCLYGRKWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 410 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALE+ RRFQWVFFRVENEWNK Sbjct: 411 TVFTITALEMFRRFQWVFFRVENEWNK 437 >ref|XP_002310465.2| hypothetical protein POPTR_0007s02660g [Populus trichocarpa] gi|550333982|gb|EEE90915.2| hypothetical protein POPTR_0007s02660g [Populus trichocarpa] Length = 470 Score = 171 bits (432), Expect = 1e-40 Identities = 75/87 (86%), Positives = 81/87 (93%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLS FTRIFKFNKP+LCSHLL+GRKWVYFWVIGSN +LR WTYKLSAHLRHNYL Sbjct: 357 VTRDWDLSCFTRIFKFNKPSLCSHLLHGRKWVYFWVIGSNFILRLAWTYKLSAHLRHNYL 416 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALE++RRFQWVFFRVENEW K Sbjct: 417 TVFTITALEMIRRFQWVFFRVENEWTK 443 >ref|XP_006854429.1| hypothetical protein AMTR_s00039p00211610 [Amborella trichopoda] gi|548858105|gb|ERN15896.1| hypothetical protein AMTR_s00039p00211610 [Amborella trichopoda] Length = 475 Score = 171 bits (432), Expect = 1e-40 Identities = 74/87 (85%), Positives = 83/87 (95%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLSVF+RIFKF P+LCS++LYGR+WVY+W IGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 358 VTRDWDLSVFSRIFKFKTPHLCSNVLYGRQWVYYWAIGSNLVLRCTWTYKLSAHLRHNYL 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALE+LRRFQW+FFRVENEWNK Sbjct: 418 TVFTITALEMLRRFQWIFFRVENEWNK 444 >ref|XP_002274355.2| PREDICTED: SPX and EXS domain-containing protein 1-like [Vitis vinifera] gi|297739314|emb|CBI28965.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 171 bits (432), Expect = 1e-40 Identities = 77/87 (88%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 VTRDWDLS FTRIFKF+K +L S+LLYGR+WVYFWVIGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 358 VTRDWDLSAFTRIFKFSKASLLSNLLYGRRWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQWVFFRVENEWNK Sbjct: 418 TVFTITALEIFRRFQWVFFRVENEWNK 444 >ref|XP_006469721.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Citrus sinensis] Length = 418 Score = 170 bits (431), Expect = 2e-40 Identities = 73/87 (83%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKFN+P+LCS+L +GR+WVY WVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 303 ITRDWDLSCFTRIFKFNRPHLCSYLFHGRRWVYVWVIGSNLILRCTWTYKLSAHLRHNYL 362 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ LE+LRRFQW FFRVENEWNK Sbjct: 363 TVFAITVLEMLRRFQWAFFRVENEWNK 389 >ref|XP_006447490.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|557550101|gb|ESR60730.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 314 Score = 170 bits (431), Expect = 2e-40 Identities = 73/87 (83%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKFN+P+LCS+L +GR+WVY WVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 199 ITRDWDLSCFTRIFKFNRPHLCSYLFHGRRWVYVWVIGSNLILRCTWTYKLSAHLRHNYL 258 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ LE+LRRFQW FFRVENEWNK Sbjct: 259 TVFAITVLEMLRRFQWAFFRVENEWNK 285 >ref|XP_006447489.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|568830898|ref|XP_006469720.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Citrus sinensis] gi|557550100|gb|ESR60729.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 471 Score = 170 bits (431), Expect = 2e-40 Identities = 73/87 (83%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKFN+P+LCS+L +GR+WVY WVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 356 ITRDWDLSCFTRIFKFNRPHLCSYLFHGRRWVYVWVIGSNLILRCTWTYKLSAHLRHNYL 415 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ LE+LRRFQW FFRVENEWNK Sbjct: 416 TVFAITVLEMLRRFQWAFFRVENEWNK 442 >ref|XP_006447488.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] gi|557550099|gb|ESR60728.1| hypothetical protein CICLE_v10015128mg [Citrus clementina] Length = 437 Score = 170 bits (431), Expect = 2e-40 Identities = 73/87 (83%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKFN+P+LCS+L +GR+WVY WVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 322 ITRDWDLSCFTRIFKFNRPHLCSYLFHGRRWVYVWVIGSNLILRCTWTYKLSAHLRHNYL 381 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ LE+LRRFQW FFRVENEWNK Sbjct: 382 TVFAITVLEMLRRFQWAFFRVENEWNK 408 >ref|XP_004243116.1| PREDICTED: SPX and EXS domain-containing protein 5-like [Solanum lycopersicum] Length = 461 Score = 170 bits (431), Expect = 2e-40 Identities = 74/87 (85%), Positives = 81/87 (93%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FT +FKFNKP++ SH LYGRKWVYFWVIGSNL+LRCTWTYKLSAHLRHNYL Sbjct: 343 LTRDWDLSCFTVVFKFNKPHILSHYLYGRKWVYFWVIGSNLILRCTWTYKLSAHLRHNYL 402 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALE+ RRFQWVFFRVENEWNK Sbjct: 403 TVFTITALEMFRRFQWVFFRVENEWNK 429 >ref|XP_006367309.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Solanum tuberosum] Length = 473 Score = 170 bits (430), Expect = 2e-40 Identities = 74/87 (85%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKF++PN S+LLYGRKWVYFWVIG+NL+LRCTWTYKLS+HLRHNYL Sbjct: 358 LTRDWDLSCFTRIFKFSRPNALSYLLYGRKWVYFWVIGTNLILRCTWTYKLSSHLRHNYL 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ALEI RRFQW FFRVENEWNK Sbjct: 418 TVFAITALEIFRRFQWAFFRVENEWNK 444 >ref|XP_004238236.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Solanum lycopersicum] Length = 473 Score = 170 bits (430), Expect = 2e-40 Identities = 74/87 (85%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 +TRDWDLS FTRIFKF++PN S+LLYGRKWVYFWVIG+NL+LRCTWTYKLS+HLRHNYL Sbjct: 358 LTRDWDLSCFTRIFKFSRPNALSYLLYGRKWVYFWVIGTNLILRCTWTYKLSSHLRHNYL 417 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVFAI+ALEI RRFQW FFRVENEWNK Sbjct: 418 TVFAITALEIFRRFQWAFFRVENEWNK 444 >ref|XP_006594887.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X5 [Glycine max] Length = 435 Score = 169 bits (429), Expect = 3e-40 Identities = 75/87 (86%), Positives = 82/87 (94%) Frame = +1 Query: 1 VTRDWDLSVFTRIFKFNKPNLCSHLLYGRKWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 180 V +DWDLS FTRIFKFNKP+L SH+L+GR+WVYFWVIGSNLVLRCTWTYKLSAHLRHNYL Sbjct: 320 VNQDWDLSGFTRIFKFNKPHLFSHMLHGRRWVYFWVIGSNLVLRCTWTYKLSAHLRHNYL 379 Query: 181 TVFAISALEILRRFQWVFFRVENEWNK 261 TVF I+ALEI RRFQW+FFRVENEWNK Sbjct: 380 TVFFIAALEIFRRFQWIFFRVENEWNK 406