BLASTX nr result
ID: Paeonia25_contig00035311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035311 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW57709.1| hypothetical protein TRAVEDRAFT_150323 [Trametes ... 42 2e-06 gb|ETW83241.1| hypothetical protein HETIRDRAFT_383311 [Heterobas... 39 4e-06 gb|EMD33997.1| hypothetical protein CERSUDRAFT_56105 [Ceriporiop... 39 5e-06 ref|XP_007362475.1| hypothetical protein DICSQDRAFT_166841 [Dich... 39 6e-06 >gb|EIW57709.1| hypothetical protein TRAVEDRAFT_150323 [Trametes versicolor FP-101664 SS1] Length = 935 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -1 Query: 171 SRVSDVKLPGFETPQFLSDFFAPSE 97 SR+SDVKLP FETP FL D FA SE Sbjct: 145 SRISDVKLPTFETPDFLKDLFASSE 169 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 286 ANYKVEEFRKMSAGLYFVQDSTATDMFETASNASK 182 ANYK EEFRK S T TD F TAS K Sbjct: 107 ANYKFEEFRKKSTDFMSTVQDTVTDAFGTASGVVK 141 >gb|ETW83241.1| hypothetical protein HETIRDRAFT_383311 [Heterobasidion irregulare TC 32-1] Length = 928 Score = 38.9 bits (89), Expect(2) = 4e-06 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = -1 Query: 183 RRLRSRVSDVKLPGFETPQFLSDFFA 106 R + RVS+VKLP FETPQF+ D FA Sbjct: 130 RAVSDRVSEVKLPKFETPQFIKDLFA 155 Score = 37.4 bits (85), Expect(2) = 4e-06 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = -3 Query: 286 ANYKVEEFRKMSAGLYFVQDSTATDMFETASN 191 ANYK EEFRK S G TATD F+TAS+ Sbjct: 96 ANYKYEEFRKKSEGWINSVKDTATDAFDTASD 127 >gb|EMD33997.1| hypothetical protein CERSUDRAFT_56105 [Ceriporiopsis subvermispora B] Length = 939 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -1 Query: 180 RLRSRVSDVKLPGFETPQFLSDFFAPSE 97 R+ RVS+VKLP ETPQFL D FA E Sbjct: 144 RVSDRVSEVKLPEIETPQFLKDLFAAFE 171 Score = 37.4 bits (85), Expect(2) = 5e-06 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -3 Query: 286 ANYKVEEFRKMSAGLYFVQDSTATDMFETASNA 188 ANYK EEFRK SA TA D+ +TAS+A Sbjct: 98 ANYKFEEFRKTSANWIATAQDTAADLLDTASDA 130 >ref|XP_007362475.1| hypothetical protein DICSQDRAFT_166841 [Dichomitus squalens LYAD-421 SS1] gi|395332300|gb|EJF64679.1| hypothetical protein DICSQDRAFT_166841 [Dichomitus squalens LYAD-421 SS1] Length = 936 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = -3 Query: 286 ANYKVEEFRKMSAGLYFVQDSTATDMFETASNASKT 179 ANYK EEF+K S ++ T TD F+TAS+ +KT Sbjct: 108 ANYKFEEFKKKSNEVFSTVQDTITDAFDTASDLAKT 143 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -1 Query: 171 SRVSDVKLPGFETPQFLSDFFAPSEN 94 SRVS++KLP F+TP FL + F+ SE+ Sbjct: 146 SRVSEIKLPEFDTPDFLKNLFSSSES 171