BLASTX nr result
ID: Paeonia25_contig00035084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00035084 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase,... 58 2e-06 ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase ... 57 2e-06 ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Popu... 55 8e-06 >ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] gi|223531507|gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus communis] Length = 768 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 1 PKFRNSGKFLSLPNFLALTKNTSSLSGVLISIEVS*Y 111 PKFRN+GKFL+L +FLAL KNTSSLSGVLISIE + Y Sbjct: 474 PKFRNAGKFLTLSDFLALAKNTSSLSGVLISIEHAAY 510 >ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial [Populus trichocarpa] gi|550349069|gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial [Populus trichocarpa] Length = 495 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 PKFRNSGKFLSLPNFLALTKNTSSLSGVLISIE 99 PKF+NSGKFL+L +FLAL KNTSSLSGVLISIE Sbjct: 463 PKFKNSGKFLTLSDFLALAKNTSSLSGVLISIE 495 >ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa] gi|550349067|gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa] Length = 754 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 PKFRNSGKFLSLPNFLALTKNTSSLSGVLISIEVS*Y 111 PKF+N GKFL+L +FLAL KNTSSLSGVLISIE + Y Sbjct: 463 PKFKNLGKFLTLSDFLALAKNTSSLSGVLISIENAAY 499