BLASTX nr result
ID: Paeonia25_contig00034655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034655 (513 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL99381.1| predicted protein [Fibroporia radiculosa] 59 3e-08 gb|EIW76538.1| hypothetical protein CONPUDRAFT_157726 [Coniophor... 52 1e-06 ref|XP_002391554.1| hypothetical protein MPER_08997 [Moniliophth... 55 8e-06 >emb|CCL99381.1| predicted protein [Fibroporia radiculosa] Length = 572 Score = 58.9 bits (141), Expect(2) = 3e-08 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +2 Query: 2 QLPPVTKGSMEPFFAFDSPAWHACIERTVVLQTVYRQKD 118 QLPPVTK ++EPFFAF+ AW CIE TV L VYRQ D Sbjct: 211 QLPPVTKANIEPFFAFECDAWKRCIEHTVTLTQVYRQTD 249 Score = 24.6 bits (52), Expect(2) = 3e-08 Identities = 8/16 (50%), Positives = 14/16 (87%) Frame = +3 Query: 186 FIEVLNELRKGILTPA 233 F+ +LNELR+G ++P+ Sbjct: 252 FVSLLNELRRGAISPS 267 >gb|EIW76538.1| hypothetical protein CONPUDRAFT_157726 [Coniophora puteana RWD-64-598 SS2] Length = 729 Score = 52.4 bits (124), Expect(2) = 1e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +2 Query: 2 QLPPVTKGSMEPFFAFDSPAWHACIERTVVLQTVYRQKD 118 QLPPV KG EPFFAF+S +W CIE T+ L V+RQKD Sbjct: 212 QLPPVCKG--EPFFAFESNSWTKCIEHTINLTQVFRQKD 248 Score = 25.8 bits (55), Expect(2) = 1e-06 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +3 Query: 186 FIEVLNELRKGILTPAT 236 F+++LNE+R G ++PAT Sbjct: 251 FVDLLNEMRYGSISPAT 267 >ref|XP_002391554.1| hypothetical protein MPER_08997 [Moniliophthora perniciosa FA553] gi|215456367|gb|EEB92484.1| hypothetical protein MPER_08997 [Moniliophthora perniciosa FA553] Length = 297 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +2 Query: 2 QLPPVTKGSMEPFFAFDSPAWHACIERTVVLQTVYRQKDA 121 QLPPVTK + EP FAF+SPAW +E T+ L V+RQKD+ Sbjct: 139 QLPPVTKNNQEPTFAFESPAWKRTLEHTINLTQVFRQKDS 178