BLASTX nr result
ID: Paeonia25_contig00034487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034487 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01... 57 3e-06 >ref|XP_006354941.1| PREDICTED: B3 domain-containing protein Os01g0723500-like [Solanum tuberosum] Length = 113 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +2 Query: 227 MLNARRPHFLVTFRPSLSSEQLKIPIKFIERLEGRTFG 340 ML+ARRPHFLV F PS++SE+LKIP KFI+ +EGR G Sbjct: 1 MLDARRPHFLVGFNPSMNSEKLKIPSKFIKHMEGRDSG 38