BLASTX nr result
ID: Paeonia25_contig00034455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034455 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154583.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain... 95 1e-17 ref|XP_004140059.1| PREDICTED: U-box domain-containing protein 1... 95 1e-17 emb|CBI37755.3| unnamed protein product [Vitis vinifera] 90 4e-16 ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 1... 90 4e-16 emb|CAN59900.1| hypothetical protein VITISV_002888 [Vitis vinifera] 90 4e-16 ref|XP_007221969.1| hypothetical protein PRUPE_ppa002735mg [Prun... 87 2e-15 ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 86 5e-15 ref|XP_007041624.1| Plant U-Box 15 isoform 2 [Theobroma cacao] g... 83 5e-14 ref|XP_007041623.1| U-box domain-containing protein 15 isoform 1... 83 5e-14 emb|CAN60391.1| hypothetical protein VITISV_006494 [Vitis vinifera] 83 5e-14 ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 1... 82 1e-13 ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citr... 82 1e-13 gb|EYU36563.1| hypothetical protein MIMGU_mgv1a002804mg [Mimulus... 81 2e-13 ref|XP_007199735.1| hypothetical protein PRUPE_ppa002658mg [Prun... 79 5e-13 ref|XP_006473917.1| PREDICTED: U-box domain-containing protein 1... 79 9e-13 ref|XP_006435360.1| hypothetical protein CICLE_v10003715mg [Citr... 79 9e-13 gb|EYU38026.1| hypothetical protein MIMGU_mgv1a002670mg [Mimulus... 77 2e-12 ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 1... 77 2e-12 ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 1... 77 2e-12 ref|XP_002510676.1| Spotted leaf protein, putative [Ricinus comm... 77 2e-12 >ref|XP_004154583.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 15-like [Cucumis sativus] Length = 645 Score = 94.7 bits (234), Expect = 1e-17 Identities = 48/82 (58%), Positives = 60/82 (73%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTLVHLSLAPNYAL NLILQWC+KNN+ LPKK+ A + + +L EI S+VHNL Sbjct: 313 PKSGQTLVHLSLAPNYALKNLILQWCQKNNYELPKKEVVAGMGDTPSDLAGEISSLVHNL 372 Query: 200 LSSHLDLQ*KVANITVDTMQKQ 265 SS LD+Q + A I + + K+ Sbjct: 373 SSSQLDIQ-REAIIKIRVLSKE 393 >ref|XP_004140059.1| PREDICTED: U-box domain-containing protein 15-like [Cucumis sativus] Length = 645 Score = 94.7 bits (234), Expect = 1e-17 Identities = 48/82 (58%), Positives = 60/82 (73%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTLVHLSLAPNYAL NLILQWC+KNN+ LPKK+ A + + +L EI S+VHNL Sbjct: 313 PKSGQTLVHLSLAPNYALKNLILQWCQKNNYELPKKEVVAGMGDTPSDLAGEISSLVHNL 372 Query: 200 LSSHLDLQ*KVANITVDTMQKQ 265 SS LD+Q + A I + + K+ Sbjct: 373 SSSQLDIQ-REAIIKIRVLSKE 393 >emb|CBI37755.3| unnamed protein product [Vitis vinifera] Length = 677 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTLVHLSLAPNYAL NLILQWCEKN F LP+KD A N S ++++ +I S+V NL Sbjct: 302 PKTGQTLVHLSLAPNYALRNLILQWCEKNQFELPRKDIKAGSNGSSIQVKQKISSLVQNL 361 Query: 200 LSSHLDLQ*K 229 SS D+Q K Sbjct: 362 SSSQPDVQRK 371 >ref|XP_002279546.1| PREDICTED: U-box domain-containing protein 15 [Vitis vinifera] Length = 641 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTLVHLSLAPNYAL NLILQWCEKN F LP+KD A N S ++++ +I S+V NL Sbjct: 302 PKTGQTLVHLSLAPNYALRNLILQWCEKNQFELPRKDIKAGSNGSSIQVKQKISSLVQNL 361 Query: 200 LSSHLDLQ*K 229 SS D+Q K Sbjct: 362 SSSQPDVQRK 371 >emb|CAN59900.1| hypothetical protein VITISV_002888 [Vitis vinifera] Length = 639 Score = 89.7 bits (221), Expect = 4e-16 Identities = 45/70 (64%), Positives = 53/70 (75%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTLVHLSLAPNYAL NLILQWCEKN F LP+KD A N S ++++ +I S+V NL Sbjct: 300 PKTGQTLVHLSLAPNYALRNLILQWCEKNQFELPRKDIKAGSNGSSIQVKQKISSLVQNL 359 Query: 200 LSSHLDLQ*K 229 SS D+Q K Sbjct: 360 SSSQPDVQRK 369 >ref|XP_007221969.1| hypothetical protein PRUPE_ppa002735mg [Prunus persica] gi|462418905|gb|EMJ23168.1| hypothetical protein PRUPE_ppa002735mg [Prunus persica] Length = 639 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/70 (62%), Positives = 51/70 (72%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK +TL HLSLAPNYAL NLI+QWCEKNNF LPKK+T A S E + EI S+V L Sbjct: 307 PKTRETLAHLSLAPNYALKNLIMQWCEKNNFQLPKKETSAGQESSSTEHKEEILSLVERL 366 Query: 200 LSSHLDLQ*K 229 SSHL++Q K Sbjct: 367 SSSHLEVQRK 376 >ref|XP_002525798.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223534885|gb|EEF36572.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 655 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQ L HLSLAPN+AL NLILQWCEKNNF LPK+D + + S EL EI S+V NL Sbjct: 323 PKTGQMLDHLSLAPNFALRNLILQWCEKNNFELPKRDAFVGYDGSPAELVEEICSLVQNL 382 Query: 200 LSSHLDL 220 SS LD+ Sbjct: 383 SSSELDV 389 >ref|XP_007041624.1| Plant U-Box 15 isoform 2 [Theobroma cacao] gi|508705559|gb|EOX97455.1| Plant U-Box 15 isoform 2 [Theobroma cacao] Length = 489 Score = 82.8 bits (203), Expect = 5e-14 Identities = 43/68 (63%), Positives = 49/68 (72%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL HLSLAPN+AL NLI QWCEKNN LPKKD YAS + EL EI S+V +L Sbjct: 157 PKTGQTLDHLSLAPNFALRNLIRQWCEKNNVELPKKDRYASSDNYSAELMEEISSLVQDL 216 Query: 200 LSSHLDLQ 223 SS D++ Sbjct: 217 SSSQPDVR 224 >ref|XP_007041623.1| U-box domain-containing protein 15 isoform 1 [Theobroma cacao] gi|508705558|gb|EOX97454.1| U-box domain-containing protein 15 isoform 1 [Theobroma cacao] Length = 633 Score = 82.8 bits (203), Expect = 5e-14 Identities = 43/68 (63%), Positives = 49/68 (72%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL HLSLAPN+AL NLI QWCEKNN LPKKD YAS + EL EI S+V +L Sbjct: 301 PKTGQTLDHLSLAPNFALRNLIRQWCEKNNVELPKKDRYASSDNYSAELMEEISSLVQDL 360 Query: 200 LSSHLDLQ 223 SS D++ Sbjct: 361 SSSQPDVR 368 >emb|CAN60391.1| hypothetical protein VITISV_006494 [Vitis vinifera] Length = 536 Score = 82.8 bits (203), Expect = 5e-14 Identities = 42/67 (62%), Positives = 50/67 (74%) Frame = +2 Query: 32 QTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNLLSSH 211 QTLVHLSLAPNYAL NLILQWCEKN F LP+KD A N S ++++ + S+V NL SS Sbjct: 331 QTLVHLSLAPNYALRNLILQWCEKNQFELPRKDIKAGFNGSSIQVKQKNSSLVQNLSSSQ 390 Query: 212 LDLQ*KV 232 D+Q KV Sbjct: 391 PDVQRKV 397 >ref|XP_006486608.1| PREDICTED: U-box domain-containing protein 15-like [Citrus sinensis] Length = 643 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/68 (60%), Positives = 48/68 (70%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQ L HLSLAPNYAL NLI+QWCEKNN LPKKDT + S L EI S++ NL Sbjct: 311 PKTGQILDHLSLAPNYALRNLIVQWCEKNNVELPKKDTNTGSDASSAALIEEICSLIQNL 370 Query: 200 LSSHLDLQ 223 SS L+++ Sbjct: 371 SSSQLNIK 378 >ref|XP_006422439.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] gi|557524373|gb|ESR35679.1| hypothetical protein CICLE_v10028003mg [Citrus clementina] Length = 643 Score = 81.6 bits (200), Expect = 1e-13 Identities = 41/68 (60%), Positives = 48/68 (70%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQ L HLSLAPNYAL NLI+QWCEKNN LPKKDT + S L EI S++ NL Sbjct: 311 PKTGQILDHLSLAPNYALRNLIVQWCEKNNVELPKKDTNTGSDASSAALIEEICSLIQNL 370 Query: 200 LSSHLDLQ 223 SS L+++ Sbjct: 371 SSSQLNIK 378 >gb|EYU36563.1| hypothetical protein MIMGU_mgv1a002804mg [Mimulus guttatus] Length = 636 Score = 80.9 bits (198), Expect = 2e-13 Identities = 42/70 (60%), Positives = 49/70 (70%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL HLSLAPN+AL NLILQWCEKNNF LPKK+ + + A+I ++V NL Sbjct: 325 PKTGQTLEHLSLAPNFALKNLILQWCEKNNFHLPKKEVLTNEETHSTKNEAKILTLVQNL 384 Query: 200 LSSHLDLQ*K 229 SS LD Q K Sbjct: 385 SSSKLDEQRK 394 >ref|XP_007199735.1| hypothetical protein PRUPE_ppa002658mg [Prunus persica] gi|462395135|gb|EMJ00934.1| hypothetical protein PRUPE_ppa002658mg [Prunus persica] Length = 647 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL HLSLAPN+AL NLILQWCEKNNF LPKK+ A + S E+ E+ +V NL Sbjct: 315 PKTGQTLDHLSLAPNFALKNLILQWCEKNNFELPKKEPCAVSDDSSAEIIEEVSCLVQNL 374 Query: 200 LSSHLDL 220 S +L++ Sbjct: 375 SSCNLEV 381 >ref|XP_006473917.1| PREDICTED: U-box domain-containing protein 15-like [Citrus sinensis] Length = 643 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/68 (60%), Positives = 48/68 (70%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK QTL HLS+APNYAL NLILQWCEKNNF LPKKD + + E + EI S+V L Sbjct: 313 PKTRQTLAHLSIAPNYALKNLILQWCEKNNFKLPKKDD-SETSECTAEQKEEIVSLVEQL 371 Query: 200 LSSHLDLQ 223 SS L++Q Sbjct: 372 SSSKLEVQ 379 >ref|XP_006435360.1| hypothetical protein CICLE_v10003715mg [Citrus clementina] gi|557537482|gb|ESR48600.1| hypothetical protein CICLE_v10003715mg [Citrus clementina] Length = 643 Score = 78.6 bits (192), Expect = 9e-13 Identities = 41/68 (60%), Positives = 48/68 (70%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK QTL HLS+APNYAL NLILQWCEKNNF LPKKD + + E + EI S+V L Sbjct: 313 PKTRQTLAHLSIAPNYALKNLILQWCEKNNFKLPKKDD-SETSECTAEQKEEIVSLVEQL 371 Query: 200 LSSHLDLQ 223 SS L++Q Sbjct: 372 SSSKLEVQ 379 >gb|EYU38026.1| hypothetical protein MIMGU_mgv1a002670mg [Mimulus guttatus] Length = 648 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/73 (47%), Positives = 52/73 (71%) Frame = +2 Query: 5 GPSDLPKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*S 184 G PK GQ L ++++APN+AL NLILQWCEKNN+ LPKK+T +++ L E+ S Sbjct: 306 GHRTCPKTGQKLTYMAVAPNFALRNLILQWCEKNNYNLPKKETCDEPDIASSPLAEEVSS 365 Query: 185 VVHNLLSSHLDLQ 223 ++ +L SSH+++Q Sbjct: 366 LIQDLYSSHVNVQ 378 >ref|XP_004290058.1| PREDICTED: U-box domain-containing protein 15-like isoform 2 [Fragaria vesca subsp. vesca] Length = 625 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL H+SLAPN++L NLI QWCEKN+F LPKK++ A + S E+ EI S+V++L Sbjct: 318 PKTGQTLDHISLAPNFSLKNLIQQWCEKNHFELPKKESNAFPDGSTAEILEEISSLVYDL 377 Query: 200 LSSHLDL 220 S LD+ Sbjct: 378 SSCQLDV 384 >ref|XP_004290057.1| PREDICTED: U-box domain-containing protein 15-like isoform 1 [Fragaria vesca subsp. vesca] Length = 650 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK GQTL H+SLAPN++L NLI QWCEKN+F LPKK++ A + S E+ EI S+V++L Sbjct: 318 PKTGQTLDHISLAPNFSLKNLIQQWCEKNHFELPKKESNAFPDGSTAEILEEISSLVYDL 377 Query: 200 LSSHLDL 220 S LD+ Sbjct: 378 SSCQLDV 384 >ref|XP_002510676.1| Spotted leaf protein, putative [Ricinus communis] gi|223551377|gb|EEF52863.1| Spotted leaf protein, putative [Ricinus communis] Length = 654 Score = 77.0 bits (188), Expect = 2e-12 Identities = 42/70 (60%), Positives = 52/70 (74%) Frame = +2 Query: 20 PKEGQTLVHLSLAPNYALHNLILQWCEKNNFPLPKKDTYASLNLSVVELRAEI*SVVHNL 199 PK QTL HLS+APNYAL NLILQWCE+NNF L K++ AS + S +L EI S+VH+L Sbjct: 324 PKTRQTLAHLSVAPNYALKNLILQWCEENNFHLSTKNSSAS-SESFSDLSEEILSLVHDL 382 Query: 200 LSSHLDLQ*K 229 SS L++Q K Sbjct: 383 SSSQLEVQRK 392