BLASTX nr result
ID: Paeonia25_contig00034424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034424 (580 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001828564.2| hypothetical protein CC1G_11216 [Coprinopsis... 57 4e-06 >ref|XP_001828564.2| hypothetical protein CC1G_11216 [Coprinopsis cinerea okayama7#130] gi|298411150|gb|EAU93234.2| hypothetical protein CC1G_11216 [Coprinopsis cinerea okayama7#130] Length = 850 Score = 57.0 bits (136), Expect = 4e-06 Identities = 33/102 (32%), Positives = 51/102 (50%) Frame = +1 Query: 265 VMNKRSRSRTPEIGSSSRMLQTIPEQNDRNVQPSSKRNSYQAGGFGTVQSTPGASSSRSH 444 V+ +R P I R QT P Q+ ++ + + G Q+ PG+SS + H Sbjct: 20 VVGQRRGENAPGISLDQRS-QTPPNQSQQSTRVDTLAEREARGSSWNQQTEPGSSSQKRH 78 Query: 445 GTPPPVSQNSRISQLPTPQSPGNVAAYASALASSPKSPMPHS 570 P + SQLPTPQSP + + +A+ + SP+SP+P S Sbjct: 79 EGLLPSFSTKQYSQLPTPQSPSDSSRFAAGVGLSPESPIPLS 120