BLASTX nr result
ID: Paeonia25_contig00034402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034402 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW62798.1| hypothetical protein TRAVEDRAFT_141295 [Trametes ... 72 8e-11 ref|XP_007361643.1| hypothetical protein DICSQDRAFT_31885, parti... 60 4e-07 >gb|EIW62798.1| hypothetical protein TRAVEDRAFT_141295 [Trametes versicolor FP-101664 SS1] Length = 587 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +3 Query: 237 DHTSIPPEVWFEIFKWATNTPRAKRFAPVDAFEPQYAVTSVYGVNTPILAMRIKCTL 407 DHTS+PPE+W EIF++AT+ PRA+ AP D F P+ +G+N+PI +M KC L Sbjct: 79 DHTSLPPELWLEIFRYATHVPRARTIAPADPFTPERPANYAWGMNSPIQSMHTKCVL 135 >ref|XP_007361643.1| hypothetical protein DICSQDRAFT_31885, partial [Dichomitus squalens LYAD-421 SS1] gi|395332629|gb|EJF65007.1| hypothetical protein DICSQDRAFT_31885, partial [Dichomitus squalens LYAD-421 SS1] Length = 441 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/53 (49%), Positives = 36/53 (67%) Frame = +3 Query: 249 IPPEVWFEIFKWATNTPRAKRFAPVDAFEPQYAVTSVYGVNTPILAMRIKCTL 407 +PPE+W EIF+ AT+ PR + A D F P+ V V+G+N+PI +MR KC L Sbjct: 1 LPPELWLEIFRCATHVPRTRSIATGDPFVPERPVDYVWGMNSPIQSMRTKCML 53