BLASTX nr result
ID: Paeonia25_contig00034348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034348 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002470391.1| predicted protein [Postia placenta Mad-698-R... 56 6e-06 >ref|XP_002470391.1| predicted protein [Postia placenta Mad-698-R] gi|220730561|gb|EED84416.1| predicted protein [Postia placenta Mad-698-R] Length = 955 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -2 Query: 167 MPKPTFLQTILGRPSQSYHYAPPPATKNYHSAKKELLEAA 48 MPKPT LQT+LGRPSQSY PP K+YHSAK +L+ AA Sbjct: 1 MPKPTLLQTLLGRPSQSYALPPP---KDYHSAKNDLIRAA 37