BLASTX nr result
ID: Paeonia25_contig00034308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034308 (577 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citr... 103 3e-20 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] 103 4e-20 ref|XP_007046300.1| Allene oxide cyclase [Theobroma cacao] gi|50... 102 7e-20 gb|AFK41265.1| unknown [Lotus japonicus] 102 1e-19 ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [... 102 1e-19 ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prun... 100 3e-19 ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [... 100 3e-19 ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [... 100 3e-19 ref|XP_003614458.1| Allene oxide cyclase [Medicago truncatula] g... 100 5e-19 gb|AFK38605.1| unknown [Lotus japonicus] 100 5e-19 gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] 99 6e-19 ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]... 99 6e-19 ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phas... 99 8e-19 gb|AGU41846.1| allene oxide cyclase [Triticum aestivum] 98 1e-18 emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vul... 98 1e-18 dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare] 98 1e-18 ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloropla... 97 2e-18 ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloropla... 97 2e-18 ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloropla... 97 2e-18 gb|AEE99197.1| allene oxide cyclase 2 [Glycine max] 97 2e-18 >ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] gi|568861856|ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus sinensis] gi|557539928|gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina] Length = 257 Score = 103 bits (257), Expect = 3e-20 Identities = 48/81 (59%), Positives = 62/81 (76%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE+TYLA+TGGSG+F+GVYGQVKLH I++ K YTFY KG+ L EL+V+ V+P P Sbjct: 177 TYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPYKLFYTFYLKGVADLPQELLVKPVEPSPT 236 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +E A AAK +EPH I N+T+ Sbjct: 237 VEAAPAAKATEPHAAISNFTN 257 >gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis] Length = 247 Score = 103 bits (256), Expect = 4e-20 Identities = 50/81 (61%), Positives = 61/81 (75%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE+TYLA+TGGSG+F+GVYGQVKL II+ K YTFY KGI L EL+V+ V+P P Sbjct: 167 TYEDTYLAVTGGSGIFEGVYGQVKLQQIIFPFKLFYTFYLKGIKDLPKELLVKPVEPSPS 226 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ +AK E H TI NYTD Sbjct: 227 VEPSPSAKSCEAHATIANYTD 247 >ref|XP_007046300.1| Allene oxide cyclase [Theobroma cacao] gi|508710235|gb|EOY02132.1| Allene oxide cyclase [Theobroma cacao] Length = 256 Score = 102 bits (254), Expect = 7e-20 Identities = 47/81 (58%), Positives = 63/81 (77%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE++YLA+TGGSG+F+GVYGQVKL I++ +K YTFY KGI L E++ + V P P Sbjct: 176 TYEDSYLAVTGGSGIFQGVYGQVKLQQIVFPIKLFYTFYLKGIPDLPAEILGKPVAPSPA 235 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK +EPH TIPN+T+ Sbjct: 236 VEPSAAAKATEPHGTIPNFTN 256 >gb|AFK41265.1| unknown [Lotus japonicus] Length = 256 Score = 102 bits (253), Expect = 1e-19 Identities = 47/81 (58%), Positives = 63/81 (77%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TY++TYLA+TGGSG+F+GVYGQVKL +++ K YTFY KGI L EL+ + VDP P Sbjct: 176 TYQDTYLAVTGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGIPDLPAELLGKPVDPSPD 235 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK +EPH T+PN+T+ Sbjct: 236 VEPSPAAKATEPHATLPNFTN 256 >ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [Glycine max] gi|332739622|gb|AEE99200.1| allene oxide cyclase 5 [Glycine max] Length = 257 Score = 102 bits (253), Expect = 1e-19 Identities = 49/81 (60%), Positives = 62/81 (76%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE++YLA+TGGSG+F+GV GQVKLH I+Y K LYTFY KGI L EL+V+ V+P P Sbjct: 177 TYEDSYLAVTGGSGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPS 236 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK EP+ TI +TD Sbjct: 237 VEPSPAAKALEPNATIAGFTD 257 >ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] gi|462411191|gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica] Length = 184 Score = 100 bits (249), Expect = 3e-19 Identities = 50/82 (60%), Positives = 63/82 (76%), Gaps = 1/82 (1%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMEL-IVEIVDP*P 490 TYE+TYLA+TGGSG+F+GVYGQVKLH I++ K LYTFY KGI L EL V++V+P P Sbjct: 103 TYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPFKILYTFYLKGIEDLPEELTAVKLVEPSP 162 Query: 491 CIEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK EP TI N+T+ Sbjct: 163 AVEPSPAAKACEPQATISNFTN 184 >ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [Glycine max] gi|332739624|gb|AEE99201.1| allene oxide cyclase 6 [Glycine max] Length = 255 Score = 100 bits (249), Expect = 3e-19 Identities = 49/81 (60%), Positives = 61/81 (75%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE+TYLA+TGGSG+F+GV GQVKL I+Y K LYTFY KGI L EL+V+ V+P P Sbjct: 175 TYEDTYLAVTGGSGIFEGVKGQVKLRQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPS 234 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK EP+ TI +TD Sbjct: 235 VEPSPAAKALEPNATIAGFTD 255 >ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max] gi|332739620|gb|AEE99199.1| allene oxide cyclase 4 [Glycine max] Length = 253 Score = 100 bits (249), Expect = 3e-19 Identities = 47/81 (58%), Positives = 59/81 (72%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE+TYLA+TGGSG+F+G YGQVKLH I++ K YTFY KGI L EL+ + V+P P Sbjct: 173 TYEDTYLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELLSQPVEPSPA 232 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 IEP+ +AK EPH I +TD Sbjct: 233 IEPSPSAKACEPHAVIAGFTD 253 >ref|XP_003614458.1| Allene oxide cyclase [Medicago truncatula] gi|40644132|emb|CAC83767.1| allene oxide cyclase [Medicago truncatula] gi|217072286|gb|ACJ84503.1| unknown [Medicago truncatula] gi|355515793|gb|AES97416.1| Allene oxide cyclase [Medicago truncatula] gi|388495314|gb|AFK35723.1| unknown [Medicago truncatula] Length = 252 Score = 99.8 bits (247), Expect = 5e-19 Identities = 44/81 (54%), Positives = 63/81 (77%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TY++TYLA+TGGSG+F+GVYGQVKL +++ K YTFY KG+ L +L+ + VDP P Sbjct: 172 TYQDTYLAITGGSGIFEGVYGQVKLQQLVFPFKLFYTFYLKGVADLPADLLGKPVDPSPH 231 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK +EPH ++PN+T+ Sbjct: 232 VEPSTAAKATEPHASLPNFTN 252 >gb|AFK38605.1| unknown [Lotus japonicus] Length = 248 Score = 99.8 bits (247), Expect = 5e-19 Identities = 46/81 (56%), Positives = 60/81 (74%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSG+F+GVYGQVKL+ I++ K YTFY KGI L EL+ + V+P P Sbjct: 168 TYEESYLAVTGGSGIFEGVYGQVKLNQIVFPFKLFYTFYLKGIKDLPQELLAKPVEPSPA 227 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AAK EPH + +TD Sbjct: 228 VEPSPAAKACEPHAVVAGFTD 248 >gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis] Length = 238 Score = 99.4 bits (246), Expect = 6e-19 Identities = 48/81 (59%), Positives = 58/81 (71%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ V P P Sbjct: 158 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPT 217 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+TD Sbjct: 218 VEPTPAAKATEPHACLNNFTD 238 >ref|NP_001240200.1| membrane primary amine oxidase [Glycine max] gi|332739618|gb|AEE99198.1| allene oxide cyclase 3 [Glycine max] Length = 257 Score = 99.4 bits (246), Expect = 6e-19 Identities = 46/81 (56%), Positives = 59/81 (72%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE+TYLA+TGGSG+F+G YGQVKLH I++ K YTFY KGI L EL+ + V+P P Sbjct: 177 TYEDTYLAVTGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGIKDLPQELLSKPVEPSPS 236 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ +AK EPH I +TD Sbjct: 237 VEPSPSAKACEPHAVIAGFTD 257 >ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris] gi|561012462|gb|ESW11323.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris] Length = 250 Score = 99.0 bits (245), Expect = 8e-19 Identities = 48/81 (59%), Positives = 61/81 (75%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYE++YLA+TGGSG+F+GV GQVKLH I+Y K LYTFY KGI L EL+V+ V+P P Sbjct: 170 TYEDSYLAVTGGSGIFEGVKGQVKLHQIVYPFKILYTFYLKGIKDLPQELLVKTVEPIPS 229 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +E + AAK EP+ TI +TD Sbjct: 230 VEASPAAKALEPNATIAGFTD 250 >gb|AGU41846.1| allene oxide cyclase [Triticum aestivum] Length = 238 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/81 (59%), Positives = 59/81 (72%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ V P P Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPT 217 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+TD Sbjct: 218 VEPTPAAKATEPHACLNNFTD 238 >emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vulgare] Length = 238 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/81 (59%), Positives = 59/81 (72%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ V P P Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPT 217 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+TD Sbjct: 218 VEPTPAAKATEPHACLNNFTD 238 >dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 238 Score = 98.2 bits (243), Expect = 1e-18 Identities = 48/81 (59%), Positives = 59/81 (72%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+GVYGQVKL+ I++ K YTFY KGI L EL+ V P P Sbjct: 158 TYEESYLAVTGGSGVFEGVYGQVKLNQIVFPFKIFYTFYLKGIPDLPKELLCTPVPPSPT 217 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+TD Sbjct: 218 VEPTPAAKATEPHACLNNFTD 238 >ref|XP_003562363.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 256 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/81 (58%), Positives = 58/81 (71%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ V P P Sbjct: 176 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPT 235 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+T+ Sbjct: 236 VEPTPAAKAAEPHACLNNFTN 256 >ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 1 [Brachypodium distachyon] Length = 243 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/81 (58%), Positives = 58/81 (71%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TYEE+YLA+TGGSGVF+G YGQVKLH I++ K YTFY KGI L EL+ V P P Sbjct: 163 TYEESYLAVTGGSGVFEGAYGQVKLHQIVFPFKIFYTFYLKGIPDLPRELLCTPVPPSPT 222 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP AAK +EPH + N+T+ Sbjct: 223 VEPTPAAKAAEPHACLNNFTN 243 >ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Glycine max] Length = 255 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/81 (53%), Positives = 62/81 (76%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TY++TYLA++GGSG+F+GVYGQVKLH +++ K YTFY KG+ L EL+ + V+P P Sbjct: 175 TYQDTYLAVSGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPS 234 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AA +EPH +PN+T+ Sbjct: 235 VEPSPAAMATEPHACLPNFTN 255 >gb|AEE99197.1| allene oxide cyclase 2 [Glycine max] Length = 255 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/81 (53%), Positives = 62/81 (76%) Frame = +2 Query: 314 TYEETYLAMTGGSGVFKGVYGQVKLHNIIYLVK*LYTFYSKGILALSMELIVEIVDP*PC 493 TY++TYLA++GGSG+F+GVYGQVKLH +++ K YTFY KG+ L EL+ + V+P P Sbjct: 175 TYQDTYLAVSGGSGIFEGVYGQVKLHQLVFPFKLFYTFYLKGVPDLPPELLGKPVEPSPS 234 Query: 494 IEPAEAAKKSEPHDTIPNYTD 556 +EP+ AA +EPH +PN+T+ Sbjct: 235 VEPSPAAMATEPHACLPNFTN 255