BLASTX nr result
ID: Paeonia25_contig00034075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00034075 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD37588.1| hypothetical protein CERSUDRAFT_114227 [Ceriporio... 58 2e-06 >gb|EMD37588.1| hypothetical protein CERSUDRAFT_114227 [Ceriporiopsis subvermispora B] Length = 888 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = +3 Query: 69 EPPSSTQSQGISPSEVRDLRHEMENLRRAMQGIGVESLEPPPTYVG 206 EPPSS S G+SPSEV +LR E+ENLRR MQ I + +EPPP Y G Sbjct: 844 EPPSSN-SGGLSPSEVSELRTEVENLRRVMQEIQADRMEPPPGYTG 888