BLASTX nr result
ID: Paeonia25_contig00033873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033873 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007360672.1| hypothetical protein DICSQDRAFT_176918 [Dich... 58 1e-06 >ref|XP_007360672.1| hypothetical protein DICSQDRAFT_176918 [Dichomitus squalens LYAD-421 SS1] gi|395334888|gb|EJF67264.1| hypothetical protein DICSQDRAFT_176918 [Dichomitus squalens LYAD-421 SS1] Length = 610 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/52 (59%), Positives = 41/52 (78%), Gaps = 1/52 (1%) Frame = +3 Query: 45 MEGQLRPKVAIKLDYERPTRPPSPYKAQVHVQTKSLSPPL-RPKAKINSSAT 197 MEGQ++PKV ++D++RP RP SP+K+ + SLSPPL RPKAK+NSSAT Sbjct: 1 MEGQMKPKVTARVDFDRP-RPASPFKS----PSTSLSPPLIRPKAKVNSSAT 47