BLASTX nr result
ID: Paeonia25_contig00033748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033748 (262 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628657.1| hypothetical protein MTR_8g063140 [Medicago ... 57 4e-06 >ref|XP_003628657.1| hypothetical protein MTR_8g063140 [Medicago truncatula] gi|355522679|gb|AET03133.1| hypothetical protein MTR_8g063140 [Medicago truncatula] Length = 69 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 169 MVSWCSWLSRQSNTLKVSGSSPGDANFFLF 80 MVSWCSWLSRQSNTLKVSGS+PG+A F F Sbjct: 1 MVSWCSWLSRQSNTLKVSGSNPGEAIFMKF 30