BLASTX nr result
ID: Paeonia25_contig00033250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033250 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007051013.1| RNA helicase family protein, putative [Theob... 57 3e-06 >ref|XP_007051013.1| RNA helicase family protein, putative [Theobroma cacao] gi|508703274|gb|EOX95170.1| RNA helicase family protein, putative [Theobroma cacao] Length = 1264 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = -3 Query: 204 LQNMGQFVDLKCEQDSW--RGGDSNAIILPQKKRNKQKSTSQGHKKVKAKENPKLSKSQ 34 +++ G V+L QDSW G DSNA+ILP K+ K+K + +K K K+NPKLSKSQ Sbjct: 1 MESSGLPVELMTGQDSWSLEGSDSNALILPTKRSRKRKENNMELEKAKGKQNPKLSKSQ 59