BLASTX nr result
ID: Paeonia25_contig00033238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033238 (580 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS96030.1| hypothetical protein FOMPIDRAFT_146097 [Fomitopsi... 56 6e-06 ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Posti... 56 8e-06 >gb|EPS96030.1| hypothetical protein FOMPIDRAFT_146097 [Fomitopsis pinicola FP-58527 SS1] Length = 155 Score = 56.2 bits (134), Expect = 6e-06 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +1 Query: 409 FSNLLSFVTLGCLFLLANGESHTVAVSNHCGFGTPLLRAENGVILSEGATVTIQGEL 579 F+ ++S TL L L A ESHTV+ SN+CG GTP+LR++NGV+LS+G T G L Sbjct: 6 FATIVS--TLSALALAA-AESHTVSFSNNCGTGTPILRSQNGVVLSQGEDYTSSGSL 59 >ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] gi|220726977|gb|EED80910.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] Length = 131 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 412 SNLLSF-VTLGCLFLLANGESHTVAVSNHCGFGTPLLRAENGVILSEGATVTIQGEL 579 S L +F + + F+ N ESHTV +N CG+GTP LRA NG +LS G + T G L Sbjct: 3 SELTTFALAVALAFVQVNAESHTVTFNNRCGYGTPYLRASNGAVLSTGGSYTSNGAL 59