BLASTX nr result
ID: Paeonia25_contig00033181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033181 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74230.1| hypothetical protein VITISV_000585 [Vitis vinifera] 55 8e-06 >emb|CAN74230.1| hypothetical protein VITISV_000585 [Vitis vinifera] Length = 334 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 244 TKSSQQFHLYHSDQPGLVLVTKLLNGENYSTWSRAMLI 131 T++ F L+HSD PG+VLV+K+L G+NYSTWSRAM I Sbjct: 15 TEALDPFSLHHSDHPGMVLVSKVLEGDNYSTWSRAMRI 52