BLASTX nr result
ID: Paeonia25_contig00033135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033135 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD38349.1| hypothetical protein CERSUDRAFT_82603 [Ceriporiop... 70 3e-10 gb|EIW62374.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 68 2e-09 gb|EMD40943.1| hypothetical protein CERSUDRAFT_103315 [Ceriporio... 65 2e-08 gb|EIW54929.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 64 3e-08 ref|XP_007401814.1| hypothetical protein PHACADRAFT_131561 [Phan... 64 4e-08 ref|XP_007391462.1| hypothetical protein PHACADRAFT_88318 [Phane... 63 5e-08 gb|EIW54977.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 63 7e-08 ref|XP_007391404.1| hypothetical protein PHACADRAFT_112917 [Phan... 62 1e-07 gb|EIW55926.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 62 1e-07 gb|EMD33549.1| hypothetical protein CERSUDRAFT_67761 [Ceriporiop... 61 2e-07 ref|XP_007370631.1| cytochrome P450 [Dichomitus squalens LYAD-42... 61 2e-07 gb|EIW54990.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 61 2e-07 ref|XP_007401818.1| hypothetical protein PHACADRAFT_214286 [Phan... 59 8e-07 gb|EIW54974.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 59 8e-07 ref|XP_007394327.1| hypothetical protein PHACADRAFT_253633 [Phan... 59 1e-06 ref|XP_007368219.1| cytochrome P450 [Dichomitus squalens LYAD-42... 59 1e-06 ref|XP_007401817.1| hypothetical protein PHACADRAFT_265429 [Phan... 57 3e-06 gb|EIW54967.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] 57 3e-06 ref|XP_003031765.1| hypothetical protein SCHCODRAFT_15801 [Schiz... 57 4e-06 ref|XP_001879496.1| predicted protein [Laccaria bicolor S238N-H8... 57 4e-06 >gb|EMD38349.1| hypothetical protein CERSUDRAFT_82603 [Ceriporiopsis subvermispora B] Length = 551 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/70 (42%), Positives = 44/70 (62%) Frame = -2 Query: 212 MSLTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDF 33 MS +++ +ES +I LWR +KSP DNIPGP P +F G+L + D+ WDF Sbjct: 1 MSASIMLLESIVICCTTWFLWRSLRQIFVKSPLDNIPGPPPVSFFKGNLEQIYDRQGWDF 60 Query: 32 HRSLGEDYGS 3 ++SL +DYG+ Sbjct: 61 YKSLSQDYGA 70 >gb|EIW62374.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 523 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/63 (46%), Positives = 45/63 (71%) Frame = -2 Query: 191 IESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGED 12 +++AL+ G +LW+ F F+LK+ DN+PGP P+F+ G++ L ++ S+ FHRSLGE Sbjct: 6 LQAALLCGTTWILWKVFRGFLLKNDLDNLPGPTSPSFIYGNIRQLFNRQSFKFHRSLGET 65 Query: 11 YGS 3 YGS Sbjct: 66 YGS 68 >gb|EMD40943.1| hypothetical protein CERSUDRAFT_103315 [Ceriporiopsis subvermispora B] Length = 550 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/70 (41%), Positives = 43/70 (61%) Frame = -2 Query: 212 MSLTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDF 33 MS V+ ++S LI LWR F I+KSP DN+PGP+P +F G+L + ++ W F Sbjct: 1 MSAIVVLLQSLLICATSWFLWRFFRQIIVKSPLDNVPGPRPVSFWKGNLPEVYNQRGWRF 60 Query: 32 HRSLGEDYGS 3 + L ++YGS Sbjct: 61 YEKLADEYGS 70 >gb|EIW54929.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 544 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/67 (40%), Positives = 44/67 (65%) Frame = -2 Query: 206 LTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHR 27 +T L +++ ++ GV LLW+ ++++S DN+PGP +F G+L + +K WDFHR Sbjct: 1 MTRLLVQAFVLGGVGWLLWKLLRPYVVRSTLDNLPGPSSQSFFYGNLKQIYNKQDWDFHR 60 Query: 26 SLGEDYG 6 SLG+ YG Sbjct: 61 SLGDLYG 67 >ref|XP_007401814.1| hypothetical protein PHACADRAFT_131561 [Phanerochaete carnosa HHB-10118-sp] gi|409040274|gb|EKM49762.1| hypothetical protein PHACADRAFT_131561 [Phanerochaete carnosa HHB-10118-sp] Length = 542 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/65 (44%), Positives = 41/65 (63%) Frame = -2 Query: 197 LAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLG 18 LA+ +AL + LWR +F+++SP DNIPGP+ P+F +GH+ L + WDFH L Sbjct: 7 LALAAALTWS----LWRLLRNFVIRSPLDNIPGPERPSFWTGHVKDLFGRHGWDFHDRLA 62 Query: 17 EDYGS 3 YGS Sbjct: 63 RQYGS 67 >ref|XP_007391462.1| hypothetical protein PHACADRAFT_88318 [Phanerochaete carnosa HHB-10118-sp] gi|409049395|gb|EKM58872.1| hypothetical protein PHACADRAFT_88318 [Phanerochaete carnosa HHB-10118-sp] Length = 561 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/69 (42%), Positives = 44/69 (63%) Frame = -2 Query: 212 MSLTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDF 33 MSL AI A + G+ +LLW+ +++L+SP D IPGP PP+ L G+++ L ++ +W F Sbjct: 1 MSLLGSAIPWAALAGLLLLLWKLARNYVLRSPLDAIPGPMPPSVLKGNMAQLQNRGAWPF 60 Query: 32 HRSLGEDYG 6 L DYG Sbjct: 61 LDHLTNDYG 69 >gb|EIW54977.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 551 Score = 62.8 bits (151), Expect = 7e-08 Identities = 26/62 (41%), Positives = 38/62 (61%) Frame = -2 Query: 191 IESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGED 12 +++ G LW+ ++KS DN+PGP P+F+ GH+ L D+ S+ FHRSLGE Sbjct: 6 LQAVFACGTIWCLWKAIRRLVIKSDLDNLPGPPSPSFVYGHIKQLYDRQSFKFHRSLGET 65 Query: 11 YG 6 YG Sbjct: 66 YG 67 >ref|XP_007391404.1| hypothetical protein PHACADRAFT_112917 [Phanerochaete carnosa HHB-10118-sp] gi|409049335|gb|EKM58812.1| hypothetical protein PHACADRAFT_112917 [Phanerochaete carnosa HHB-10118-sp] Length = 561 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/69 (40%), Positives = 44/69 (63%) Frame = -2 Query: 212 MSLTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDF 33 MSL A+ A + G+ +LLW+ +++L SP DNIPGP PP+ L G++ L ++ +W + Sbjct: 1 MSLLGPAVSWAALGGLLLLLWKLARNYVLPSPLDNIPGPAPPSTLKGNIVQLQNRGAWQY 60 Query: 32 HRSLGEDYG 6 SL +YG Sbjct: 61 LDSLTNNYG 69 >gb|EIW55926.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 551 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/62 (45%), Positives = 38/62 (61%) Frame = -2 Query: 191 IESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGED 12 I++ L G LW F F++KS DN+PGP ++L GH+ L K S+ FHRSLG+ Sbjct: 6 IQAVLACGATWFLWTIFRRFVVKSDLDNLPGPSSSSYLYGHMKQLYSKQSFGFHRSLGDK 65 Query: 11 YG 6 YG Sbjct: 66 YG 67 >gb|EMD33549.1| hypothetical protein CERSUDRAFT_67761 [Ceriporiopsis subvermispora B] Length = 548 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/70 (40%), Positives = 41/70 (58%) Frame = -2 Query: 212 MSLTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDF 33 MS + +E A+I LLW+ FI+KSP DNIPGP P + GHL + + WDF Sbjct: 1 MSAVLSVLEGAVICTATWLLWKVLRQFIVKSPLDNIPGPPPRSSWRGHLPQIYGRHEWDF 60 Query: 32 HRSLGEDYGS 3 + + ++YG+ Sbjct: 61 YHDVTQNYGT 70 >ref|XP_007370631.1| cytochrome P450 [Dichomitus squalens LYAD-421 SS1] gi|395324234|gb|EJF56679.1| cytochrome P450 [Dichomitus squalens LYAD-421 SS1] Length = 551 Score = 61.2 bits (147), Expect = 2e-07 Identities = 28/66 (42%), Positives = 39/66 (59%) Frame = -2 Query: 206 LTVLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHR 27 L+ +++ LI G + LWR F ++KS DNIPG P++L GH+ L DK W F+R Sbjct: 2 LSSAILQAVLICGSTLFLWRLFRQLLVKSDLDNIPGLPSPSYLYGHVQQLRDKQGWAFYR 61 Query: 26 SLGEDY 9 L E Y Sbjct: 62 ELAEKY 67 >gb|EIW54990.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 552 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 6/64 (9%) Frame = -2 Query: 179 LIYGVFV-----LLWRRFCSFILKSPFDNIPGPKPPTFLSGHL-SLLSDKASWDFHRSLG 18 L+ G+FV LLW+ F F++KS DN+PGP P+F+ GH+ L + + + +HRSLG Sbjct: 5 LLQGLFVCATTWLLWKAFRKFVVKSDLDNLPGPPSPSFMYGHVRELYNKQTGFKYHRSLG 64 Query: 17 EDYG 6 E YG Sbjct: 65 EKYG 68 >ref|XP_007401818.1| hypothetical protein PHACADRAFT_214286 [Phanerochaete carnosa HHB-10118-sp] gi|409040278|gb|EKM49766.1| hypothetical protein PHACADRAFT_214286 [Phanerochaete carnosa HHB-10118-sp] Length = 517 Score = 59.3 bits (142), Expect = 8e-07 Identities = 23/63 (36%), Positives = 40/63 (63%) Frame = -2 Query: 194 AIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGE 15 +++ L+ + +W+ F + I++SP DNIPGP+ TF +GH+ L ++ WDFH + + Sbjct: 4 SMQLGLLVALLWAVWKLFRNLIVRSPLDNIPGPEEATFWTGHVKALFNRHGWDFHDRIVQ 63 Query: 14 DYG 6 YG Sbjct: 64 QYG 66 >gb|EIW54974.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 552 Score = 59.3 bits (142), Expect = 8e-07 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -2 Query: 200 VLAIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSL 21 V +++ L+ +LW+ F +KS DN+PGP P+FL G+L L + S+ FH+SL Sbjct: 2 VSLLQAVLVCSATWVLWKLFRRLTVKSDLDNLPGPPSPSFLYGNLKQLYSRQSFKFHQSL 61 Query: 20 GEDYG 6 GE YG Sbjct: 62 GETYG 66 >ref|XP_007394327.1| hypothetical protein PHACADRAFT_253633 [Phanerochaete carnosa HHB-10118-sp] gi|409047001|gb|EKM56480.1| hypothetical protein PHACADRAFT_253633 [Phanerochaete carnosa HHB-10118-sp] Length = 560 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/54 (42%), Positives = 36/54 (66%) Frame = -2 Query: 167 VFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGEDYG 6 + +LLW+ +++L+SP D IPGP PP+ L G+++ L D+ +W F L DYG Sbjct: 16 LLLLLWKLVGNYVLRSPLDAIPGPTPPSLLKGNMAQLQDRGAWPFLNHLTNDYG 69 >ref|XP_007368219.1| cytochrome P450 [Dichomitus squalens LYAD-421 SS1] gi|395326692|gb|EJF59099.1| cytochrome P450 [Dichomitus squalens LYAD-421 SS1] Length = 532 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -2 Query: 185 SALIYGVFVLL-WRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGEDY 9 SA++ + LL WR + KSP D +PGP +FL+GHLS ++D SWDFH + E Y Sbjct: 3 SAIVCTLIALLAWRLVRALTPKSPLDIVPGPIATSFLTGHLSQITDTQSWDFHSHIAEKY 62 Query: 8 G 6 G Sbjct: 63 G 63 >ref|XP_007401817.1| hypothetical protein PHACADRAFT_265429 [Phanerochaete carnosa HHB-10118-sp] gi|409040277|gb|EKM49765.1| hypothetical protein PHACADRAFT_265429 [Phanerochaete carnosa HHB-10118-sp] Length = 542 Score = 57.4 bits (137), Expect = 3e-06 Identities = 22/63 (34%), Positives = 42/63 (66%) Frame = -2 Query: 194 AIESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGE 15 +++ L+ + LWR F +F+++SP DNIPGP+ +F +G++ L ++ W+FH ++ + Sbjct: 4 SLQLILLAALAWALWRLFRTFVIRSPLDNIPGPQRSSFWTGNIKDLFNRHGWNFHDTIAQ 63 Query: 14 DYG 6 YG Sbjct: 64 QYG 66 >gb|EIW54967.1| cytochrome P450 [Trametes versicolor FP-101664 SS1] Length = 552 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/51 (52%), Positives = 32/51 (62%) Frame = -2 Query: 158 LLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGEDYG 6 LLW F LKS DN+PGP P+FL G+L L S+ FH+SLGE YG Sbjct: 16 LLWTLFRRLTLKSDLDNLPGPPSPSFLYGNLRQLYSNQSFKFHKSLGEKYG 66 >ref|XP_003031765.1| hypothetical protein SCHCODRAFT_15801 [Schizophyllum commune H4-8] gi|300105458|gb|EFI96862.1| hypothetical protein SCHCODRAFT_15801 [Schizophyllum commune H4-8] Length = 542 Score = 57.0 bits (136), Expect = 4e-06 Identities = 23/52 (44%), Positives = 32/52 (61%) Frame = -2 Query: 158 LLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGEDYGS 3 L WR F+L++P DNIPGP P+ L+G+ L + W+FH L +YGS Sbjct: 17 LFWRFVNRFVLRTPLDNIPGPASPSVLTGNFQQLYSVSGWEFHAKLAREYGS 68 >ref|XP_001879496.1| predicted protein [Laccaria bicolor S238N-H82] gi|164645864|gb|EDR10111.1| predicted protein [Laccaria bicolor S238N-H82] Length = 511 Score = 57.0 bits (136), Expect = 4e-06 Identities = 22/62 (35%), Positives = 36/62 (58%) Frame = -2 Query: 191 IESALIYGVFVLLWRRFCSFILKSPFDNIPGPKPPTFLSGHLSLLSDKASWDFHRSLGED 12 +++ ++ +F + WR C + K+ DNIPGP P+FL G+ L + WDFH+ + Sbjct: 6 LKAIVLLSLFWICWRIVCQRLFKTALDNIPGPPSPSFLKGNFPQLFNINGWDFHKDIASK 65 Query: 11 YG 6 YG Sbjct: 66 YG 67