BLASTX nr result
ID: Paeonia25_contig00033133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033133 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007382101.1| hypothetical protein PUNSTDRAFT_43449 [Punct... 62 8e-08 >ref|XP_007382101.1| hypothetical protein PUNSTDRAFT_43449 [Punctularia strigosozonata HHB-11173 SS5] gi|390601195|gb|EIN10589.1| hypothetical protein PUNSTDRAFT_43449 [Punctularia strigosozonata HHB-11173 SS5] Length = 661 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/92 (35%), Positives = 51/92 (55%), Gaps = 1/92 (1%) Frame = -2 Query: 308 RHPFADKVDFELH-LLEADGSYDFFDDAGGLELIQVRKLLKQVPFRTNEAKIDYRGSDNY 132 R PFAD V EL +++ DGS + F +L K +P++ EA + + Y Sbjct: 464 RRPFADDVTVELRRIIDPDGSKEGFSLGA--------RLGKAIPWKNGEAVVPHDQDALY 515 Query: 131 AFLLRNRSSTALYPHLMYFDPSTYAIEHWYSP 36 A +LRN T LYP++ + DP+TYA++ +Y P Sbjct: 516 ALVLRNYGKTPLYPYVFWMDPATYAVDDFYKP 547