BLASTX nr result
ID: Paeonia25_contig00033070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033070 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM01757.1| predicted protein [Fibroporia radiculosa] 77 2e-12 ref|XP_007392493.1| hypothetical protein PHACADRAFT_250766 [Phan... 77 2e-12 gb|EMD36319.1| hypothetical protein CERSUDRAFT_115252 [Ceriporio... 76 5e-12 ref|XP_007392185.1| hypothetical protein PHACADRAFT_250247 [Phan... 74 2e-11 ref|XP_007383962.1| GMC oxidoreductase [Punctularia strigosozona... 74 3e-11 emb|CCM01756.1| predicted protein [Fibroporia radiculosa] 73 4e-11 gb|EIW61651.1| GMC oxidoreductase [Trametes versicolor FP-101664... 73 4e-11 gb|EPS98728.1| hypothetical protein FOMPIDRAFT_1125896 [Fomitops... 73 5e-11 gb|EPQ53452.1| alcohol oxidase [Gloeophyllum trabeum ATCC 11539] 72 6e-11 gb|ETW75690.1| GMC oxidoreductase 1 [Heterobasidion irregulare T... 72 8e-11 gb|EPQ53463.1| alcohol oxidase [Gloeophyllum trabeum ATCC 11539] 72 1e-10 ref|XP_003037687.1| GMC oxidoreductase [Schizophyllum commune H4... 72 1e-10 gb|ETW76923.1| GMC oxidoreductase 11 [Heterobasidion irregulare ... 71 1e-10 ref|XP_002388566.1| hypothetical protein MPER_12396 [Moniliophth... 71 1e-10 gb|EPS94467.1| hypothetical protein FOMPIDRAFT_152880 [Fomitopsi... 71 2e-10 ref|XP_007365084.1| alcohol oxidase [Dichomitus squalens LYAD-42... 70 2e-10 ref|XP_007383884.1| alcohol oxidase, partial [Punctularia strigo... 70 2e-10 ref|XP_007311495.1| GMC oxidoreductase [Stereum hirsutum FP-9166... 70 2e-10 gb|ESK92577.1| gmc oxidoreductase [Moniliophthora roreri MCA 2997] 70 4e-10 gb|ETW75677.1| choline dehydrogenase 3 [Heterobasidion irregular... 69 5e-10 >emb|CCM01757.1| predicted protein [Fibroporia radiculosa] Length = 598 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP LKVYGT NLRVVDLS++P+HFASHPQS VY IAE ADI K Sbjct: 541 VVDPSLKVYGTNNLRVVDLSVLPLHFASHPQSTVYAIAEQAADIIK 586 >ref|XP_007392493.1| hypothetical protein PHACADRAFT_250766 [Phanerochaete carnosa HHB-10118-sp] gi|409050467|gb|EKM59944.1| hypothetical protein PHACADRAFT_250766 [Phanerochaete carnosa HHB-10118-sp] Length = 588 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/47 (80%), Positives = 40/47 (85%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKA 147 VVD LKVYGT+NLRVVDLSIVP+HFASHPQS VY IAE ADI KA Sbjct: 540 VVDTDLKVYGTSNLRVVDLSIVPLHFASHPQSAVYAIAEKAADIIKA 586 >gb|EMD36319.1| hypothetical protein CERSUDRAFT_115252 [Ceriporiopsis subvermispora B] Length = 602 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKA 147 VVDPKLKVYGTTN+RVVD+SI+P+H SH Q+V YGIAE ADI KA Sbjct: 554 VVDPKLKVYGTTNVRVVDISIIPLHVGSHTQAVAYGIAEQAADIIKA 600 >ref|XP_007392185.1| hypothetical protein PHACADRAFT_250247 [Phanerochaete carnosa HHB-10118-sp] gi|409050150|gb|EKM59627.1| hypothetical protein PHACADRAFT_250247 [Phanerochaete carnosa HHB-10118-sp] Length = 621 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKA 147 VVD LKVYGT+NLRVVDLSI+P+HFASH QS VY IAE ADI KA Sbjct: 573 VVDTNLKVYGTSNLRVVDLSIIPLHFASHSQSTVYAIAEKAADIIKA 619 >ref|XP_007383962.1| GMC oxidoreductase [Punctularia strigosozonata HHB-11173 SS5] gi|390599869|gb|EIN09265.1| GMC oxidoreductase [Punctularia strigosozonata HHB-11173 SS5] Length = 598 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/52 (67%), Positives = 43/52 (82%), Gaps = 1/52 (1%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGAD-ISKAVPLI 135 VVDP+LKVYGT NLRVVDLS+VP+HFA+HPQ+ VY +AE AD I +A +I Sbjct: 547 VVDPELKVYGTNNLRVVDLSVVPLHFAAHPQATVYALAEQAADRIKEAAKVI 598 >emb|CCM01756.1| predicted protein [Fibroporia radiculosa] Length = 614 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+LKVYGT N+RVVDLSIVP+HFA+HPQ+ VY IAE A I K Sbjct: 555 VVDPELKVYGTNNIRVVDLSIVPLHFAAHPQATVYAIAEKAATIIK 600 >gb|EIW61651.1| GMC oxidoreductase [Trametes versicolor FP-101664 SS1] Length = 602 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADI 156 VVDP LKVYGT NLRVVDLS+VP+H A+HPQS VY IAE ADI Sbjct: 550 VVDPHLKVYGTENLRVVDLSVVPLHIAAHPQSTVYAIAEQAADI 593 >gb|EPS98728.1| hypothetical protein FOMPIDRAFT_1125896 [Fomitopsis pinicola FP-58527 SS1] Length = 612 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+LKVYGT N+RVVDLS+VP+ FA+HP S VY IAE GA+I K Sbjct: 550 VVDPELKVYGTNNIRVVDLSVVPLQFAAHPMSTVYAIAEQGAEIIK 595 >gb|EPQ53452.1| alcohol oxidase [Gloeophyllum trabeum ATCC 11539] Length = 598 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKAV 144 VVD KLKVYGTTN+RV DLS++P+HFA+HPQ+ Y I E ADI K V Sbjct: 550 VVDSKLKVYGTTNVRVADLSVIPLHFAAHPQATAYAIGEQAADIIKGV 597 >gb|ETW75690.1| GMC oxidoreductase 1 [Heterobasidion irregulare TC 32-1] Length = 601 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+LKVYGT NLRVVD+S++P+ FA+H QSVVYG+AE ADI K Sbjct: 553 VVDPQLKVYGTENLRVVDMSVIPLLFAAHTQSVVYGLAEQAADIIK 598 >gb|EPQ53463.1| alcohol oxidase [Gloeophyllum trabeum ATCC 11539] Length = 599 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDPKLKVYGT+N+RV D+S++P+HFASH Q+ VY I E ADI K Sbjct: 551 VVDPKLKVYGTSNIRVADISVIPLHFASHTQATVYAIGEQAADIIK 596 >ref|XP_003037687.1| GMC oxidoreductase [Schizophyllum commune H4-8] gi|300111384|gb|EFJ02785.1| GMC oxidoreductase [Schizophyllum commune H4-8] Length = 609 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKAV 144 VVDP+LKVYGT+NLRV+D S++PIH ++H QS V GIAE GADI K V Sbjct: 561 VVDPQLKVYGTSNLRVIDASVIPIHISAHIQSTVVGIAEYGADIIKGV 608 >gb|ETW76923.1| GMC oxidoreductase 11 [Heterobasidion irregulare TC 32-1] Length = 628 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+LKVYGT+NLRVVDLS+VP+ FA+H QSVVYG+AE A I K Sbjct: 580 VVDPRLKVYGTSNLRVVDLSVVPLLFAAHSQSVVYGLAEQAAAIIK 625 >ref|XP_002388566.1| hypothetical protein MPER_12396 [Moniliophthora perniciosa FA553] gi|215449973|gb|EEB89496.1| hypothetical protein MPER_12396 [Moniliophthora perniciosa FA553] Length = 480 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMG 165 VVDP LKVYGT N+RVVDLSIVP+HFA+HPQ+ VY IAE G Sbjct: 270 VVDPSLKVYGTKNIRVVDLSIVPLHFAAHPQATVYAIAEQG 310 >gb|EPS94467.1| hypothetical protein FOMPIDRAFT_152880 [Fomitopsis pinicola FP-58527 SS1] Length = 590 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKAVP 141 VVDP LKVYGTTN+RV DLSI+P+HFASH QS Y + E ADI KA P Sbjct: 542 VVDPNLKVYGTTNVRVADLSILPLHFASHTQSAAYYVGEKVADILKANP 590 >ref|XP_007365084.1| alcohol oxidase [Dichomitus squalens LYAD-421 SS1] gi|395329987|gb|EJF62372.1| alcohol oxidase [Dichomitus squalens LYAD-421 SS1] Length = 597 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDPKL+VYGT NLR+ DLS++P+H A+HPQ+ VY IAE ADI K Sbjct: 549 VVDPKLQVYGTKNLRIADLSVLPLHVAAHPQATVYAIAEQAADIIK 594 >ref|XP_007383884.1| alcohol oxidase, partial [Punctularia strigosozonata HHB-11173 SS5] gi|390599791|gb|EIN09187.1| alcohol oxidase, partial [Punctularia strigosozonata HHB-11173 SS5] Length = 628 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKAV 144 VVDP LKVYGTTNLRVVDLSI+P+HFA+HP + VY IAE G ++ V Sbjct: 533 VVDPDLKVYGTTNLRVVDLSILPLHFAAHPLASVYAIAEQGKSFAQHV 580 >ref|XP_007311495.1| GMC oxidoreductase [Stereum hirsutum FP-91666 SS1] gi|389738151|gb|EIM79352.1| GMC oxidoreductase [Stereum hirsutum FP-91666 SS1] Length = 616 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+LKVYGT+NLRVVD+SIVP+ FA+H QSV+Y IAE ADI K Sbjct: 566 VVDPQLKVYGTSNLRVVDMSIVPLLFAAHVQSVLYAIAEQAADIIK 611 >gb|ESK92577.1| gmc oxidoreductase [Moniliophthora roreri MCA 2997] Length = 431 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISKAV 144 VVD LKVYGT N+RVVDLSIVP+HFA+H Q+ VY IAE ADI + V Sbjct: 382 VVDTSLKVYGTKNIRVVDLSIVPLHFAAHSQATVYAIAEQAADIIRGV 429 >gb|ETW75677.1| choline dehydrogenase 3 [Heterobasidion irregulare TC 32-1] Length = 555 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 287 VVDPKLKVYGTTNLRVVDLSIVPIHFASHPQSVVYGIAEMGADISK 150 VVDP+L+VYGT NLRVVDLS+VP+ FA+H QSVVY +AE AD+ K Sbjct: 507 VVDPQLRVYGTANLRVVDLSVVPLLFAAHTQSVVYALAEQAADLIK 552