BLASTX nr result
ID: Paeonia25_contig00033052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033052 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007381247.1| hypothetical protein PUNSTDRAFT_42890 [Punct... 59 7e-07 >ref|XP_007381247.1| hypothetical protein PUNSTDRAFT_42890 [Punctularia strigosozonata HHB-11173 SS5] gi|390602327|gb|EIN11720.1| hypothetical protein PUNSTDRAFT_42890 [Punctularia strigosozonata HHB-11173 SS5] Length = 317 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/48 (54%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -1 Query: 227 PEWETDEDPLDAL-VERAGLGIVVRTDWEDGEAWGAFVRVLRESEAQF 87 P W+TDEDP D + + AGLGI+VRTD+ D +AW +F+ LRE E +F Sbjct: 74 PAWQTDEDPFDEIAIHTAGLGILVRTDFTDDDAWQSFLAKLREGEQEF 121