BLASTX nr result
ID: Paeonia25_contig00033021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00033021 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM01894.1| predicted protein [Fibroporia radiculosa] 56 5e-06 >emb|CCM01894.1| predicted protein [Fibroporia radiculosa] Length = 538 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/86 (34%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = +3 Query: 81 PAPSEDSSNVCLASIALTCALNTSNQDSESY--IDPFSEQAYLPFMTLFGKTFDRLIAVQ 254 PA S V L S+ L + N++N+D + D F AYLP +++ G ++ +++ Sbjct: 115 PANLSVHSFVRLLSLELLLSCNSTNRDKQMVEGTDLFGTYAYLPLLSVLGNLVEKFVSLH 174 Query: 255 LVGRYSTLFGPRHERLELEKPFLPLI 332 LVG Y +FGP RL+LE ++P I Sbjct: 175 LVGWYPMIFGPWRNRLDLETTYIPSI 200