BLASTX nr result
ID: Paeonia25_contig00032933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00032933 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007327878.1| hypothetical protein AGABI1DRAFT_126501 [Aga... 56 5e-06 >ref|XP_007327878.1| hypothetical protein AGABI1DRAFT_126501 [Agaricus bisporus var. burnettii JB137-S8] gi|409081799|gb|EKM82158.1| hypothetical protein AGABI1DRAFT_126501 [Agaricus bisporus var. burnettii JB137-S8] Length = 231 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/50 (48%), Positives = 35/50 (70%) Frame = -1 Query: 171 FSNYCHVAATTILVYDFCLTVREEVQHIWFSKIGTPAVLFLLLRYVSLCD 22 F+NYC+VA+ T+L +D+ LTV E+++IW SK +LFLL RY+ D Sbjct: 13 FNNYCNVASLTLLSFDYILTVHHEIEYIWESKWNLVKILFLLTRYLPFID 62