BLASTX nr result
ID: Paeonia25_contig00032480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00032480 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279773.2| PREDICTED: regulator of telomere elongation ... 61 2e-07 ref|XP_002528200.1| regulator of telomere elongation helicase 1 ... 60 3e-07 ref|XP_003597782.1| Regulator of telomere elongation helicase [M... 58 2e-06 ref|XP_003597775.1| Regulator of telomere elongation helicase [M... 58 2e-06 ref|XP_006465547.1| PREDICTED: regulator of telomere elongation ... 57 3e-06 ref|XP_006465546.1| PREDICTED: regulator of telomere elongation ... 57 3e-06 ref|XP_004486727.1| PREDICTED: regulator of telomere elongation ... 56 5e-06 ref|XP_004486726.1| PREDICTED: regulator of telomere elongation ... 56 5e-06 ref|XP_007024116.1| Regulator of telomere elongation helicase 1 ... 55 8e-06 >ref|XP_002279773.2| PREDICTED: regulator of telomere elongation helicase 1-like [Vitis vinifera] Length = 1084 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KALKSK K G L+SIA+LFSGPER PL RFKDY+ Y+SL+++YL Sbjct: 996 KALKSKAMKIGQVLESIARLFSGPERLPLLKRFKDYIPAKYQSLYQQYL 1044 >ref|XP_002528200.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] gi|223532412|gb|EEF34207.1| regulator of telomere elongation helicase 1 rtel1, putative [Ricinus communis] Length = 1049 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KALKSK + G L+SI KLFSGP+RFPL RFKDY+ Y SL+E YL Sbjct: 958 KALKSKAMQIGSVLESIVKLFSGPDRFPLLKRFKDYIPAKYHSLYEHYL 1006 >ref|XP_003597782.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486830|gb|AES68033.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1089 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL*SR*YNF 165 KALK+KT K L SI++LFSGPER PL RFKDY+ Y SL+E+Y+ + Y F Sbjct: 1019 KALKTKTLKISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQYVEGKVYFF 1074 >ref|XP_003597775.1| Regulator of telomere elongation helicase [Medicago truncatula] gi|355486823|gb|AES68026.1| Regulator of telomere elongation helicase [Medicago truncatula] Length = 1048 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL*SR*YNF 165 KALK+KT K L SI++LFSGPER PL RFKDY+ Y SL+E+Y+ + Y F Sbjct: 978 KALKTKTLKISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQYVEGKVYFF 1033 >ref|XP_006465547.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Citrus sinensis] Length = 1032 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KA+KSK K LQSIAKLF+GPER PL RFKDY+ Y L+E+YL Sbjct: 980 KAMKSKAMKISHVLQSIAKLFAGPERLPLLRRFKDYVPAKYHPLYEQYL 1028 >ref|XP_006465546.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Citrus sinensis] Length = 1036 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KA+KSK K LQSIAKLF+GPER PL RFKDY+ Y L+E+YL Sbjct: 984 KAMKSKAMKISHVLQSIAKLFAGPERLPLLRRFKDYVPAKYHPLYEQYL 1032 >ref|XP_004486727.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X2 [Cicer arietinum] Length = 1009 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KALK+KT K L SI++LFSGPER PL RFKDY+ Y SL+E+Y+ Sbjct: 956 KALKTKTLKISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQYV 1004 >ref|XP_004486726.1| PREDICTED: regulator of telomere elongation helicase 1-like isoform X1 [Cicer arietinum] Length = 1006 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KALK+KT K L SI++LFSGPER PL RFKDY+ Y SL+E+Y+ Sbjct: 953 KALKTKTLKISEVLLSISRLFSGPERLPLLKRFKDYIPAKYHSLYEQYV 1001 >ref|XP_007024116.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] gi|508779482|gb|EOY26738.1| Regulator of telomere elongation helicase 1 rtel1, putative isoform 1 [Theobroma cacao] Length = 1052 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 1 KALKSKTTK-GPALQSIAKLFSGPERFPLRIRFKDYLGEGYRSLFEKYL 144 KA+KSK K LQSI LFSGPER PL RFKDY+ Y+SL+E+Y+ Sbjct: 992 KAMKSKVMKISNVLQSIVGLFSGPERLPLLERFKDYVPAKYQSLYEQYI 1040