BLASTX nr result
ID: Paeonia25_contig00032323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00032323 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPT01838.1| hypothetical protein FOMPIDRAFT_1119418, partial ... 56 5e-06 >gb|EPT01838.1| hypothetical protein FOMPIDRAFT_1119418, partial [Fomitopsis pinicola FP-58527 SS1] Length = 266 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +2 Query: 80 SHVCRYWRAIALDCAALWSSIDLKYGRSCVAEVLLRAKTHPLSIVTT 220 SHVC+ WRAIAL C+ALWS IDL VAE+L R+K PL + T Sbjct: 73 SHVCKQWRAIALGCSALWSCIDLHRAPEWVAELLARSKGAPLYVSMT 119