BLASTX nr result
ID: Paeonia25_contig00032051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00032051 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007410030.1| hypothetical protein MELLADRAFT_63196 [Melam... 44 5e-08 >ref|XP_007410030.1| hypothetical protein MELLADRAFT_63196 [Melampsora larici-populina 98AG31] gi|328857474|gb|EGG06590.1| hypothetical protein MELLADRAFT_63196 [Melampsora larici-populina 98AG31] Length = 376 Score = 44.3 bits (103), Expect(2) = 5e-08 Identities = 24/69 (34%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = -3 Query: 322 GDGNCGFHAIALGLGLPLKTGWLDVRKALMDHSLFNRADYAR--CWGEKSFEEVYDKLVF 149 GDGNCG+ ++A GLG K W++++K ++ NR Y++ G ++ ++K Sbjct: 186 GDGNCGYRSVAAGLGKNEK-DWVEIKKDMVKELERNRETYSQKNYSGSVFYKHSFEKFRD 244 Query: 148 LLEDKNPPV 122 LLED + PV Sbjct: 245 LLEDTDSPV 253 Score = 38.5 bits (88), Expect(2) = 5e-08 Identities = 16/39 (41%), Positives = 28/39 (71%) Frame = -2 Query: 119 KWIDLPSHAHIAANAFERVIVLINPNRHGVMTIPPSLHP 3 +W++ P+HA+I ANA++R I+L + + +T P+LHP Sbjct: 257 RWLEFPAHAYILANAYQRPIILFSALQ--PLTFFPTLHP 293