BLASTX nr result
ID: Paeonia25_contig00031493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031493 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containi... 129 5e-28 ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Popu... 126 4e-27 ref|XP_007218597.1| hypothetical protein PRUPE_ppa013339mg [Prun... 126 4e-27 gb|EYU25019.1| hypothetical protein MIMGU_mgv1a016902mg [Mimulus... 125 8e-27 ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Popu... 125 8e-27 emb|CBI24493.3| unnamed protein product [Vitis vinifera] 123 2e-26 gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] 122 4e-26 gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [M... 122 7e-26 ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containi... 122 7e-26 ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycin... 122 7e-26 ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containi... 121 1e-25 ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containi... 121 1e-25 ref|XP_007152388.1| hypothetical protein PHAVU_004G125800g [Phas... 119 3e-25 ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, part... 119 3e-25 ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containi... 119 3e-25 ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containi... 119 6e-25 ref|XP_004308153.1| PREDICTED: CDGSH iron-sulfur domain-containi... 118 1e-24 ref|XP_002510894.1| conserved hypothetical protein [Ricinus comm... 118 1e-24 gb|AFK46198.1| unknown [Lotus japonicus] 117 2e-24 ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containi... 115 6e-24 >ref|XP_002269624.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Vitis vinifera] Length = 117 Score = 129 bits (323), Expect = 5e-28 Identities = 69/113 (61%), Positives = 78/113 (69%), Gaps = 3/113 (2%) Frame = +1 Query: 22 MASVVSMVGCSRSFSME---SLNKNRRGSLGXXXXXXXXXXXXARGRVSVLVRAEAINPE 192 MASV SMVG S+S S+ + G G R +V+VRAE INPE Sbjct: 1 MASV-SMVGAGFSYSARPSPSMEALKSGRGGRSFGTQFPISSSGAARRAVVVRAETINPE 59 Query: 193 IRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNVGP 351 IRK EEKVVDSV+V+EL+KP+TAYCRCWRS TFPLCDG HVKHNKATGDNVGP Sbjct: 60 IRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGP 112 >ref|XP_002321854.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] gi|550322696|gb|EEF05981.2| hypothetical protein POPTR_0015s14240g [Populus trichocarpa] Length = 173 Score = 126 bits (316), Expect = 4e-27 Identities = 70/118 (59%), Positives = 80/118 (67%), Gaps = 4/118 (3%) Frame = +1 Query: 10 RSVTMASVVSMVGCSRSFSMESL--NKNRRGSLGXXXXXXXXXXXXARGRVSVLVRAEA- 180 R T ++SM S S + S +K+R G + R R V+VRAEA Sbjct: 55 RKATRLLIMSMTVASTSTASASFRYSKSRTGGV-------KPNIAAVRPRSLVVVRAEAQ 107 Query: 181 -INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNVGP 351 INPEIRK+EEKVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HVKHNKATGDNVGP Sbjct: 108 SINPEIRKNEEKVVDSVVVAELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGP 165 >ref|XP_007218597.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] gi|462415059|gb|EMJ19796.1| hypothetical protein PRUPE_ppa013339mg [Prunus persica] Length = 128 Score = 126 bits (316), Expect = 4e-27 Identities = 72/122 (59%), Positives = 80/122 (65%), Gaps = 12/122 (9%) Frame = +1 Query: 22 MASVVSMVGCS----RSFSMESLNKNRRGS------LGXXXXXXXXXXXXARGRVSVLVR 171 MAS+VS G + R SME L + R + L R + V+V+ Sbjct: 1 MASIVSTAGLTSCGHRKPSMEGLKLSSRKAMTFGTQLAYPVSSSSGCGYSRRMKPMVVVK 60 Query: 172 AEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNV 345 AEA INPEIRKSEEKVVDSV+VSELSKPLT YCRCWRS TFPLCDG HVKHNKATGDNV Sbjct: 61 AEAQPINPEIRKSEEKVVDSVVVSELSKPLTVYCRCWRSGTFPLCDGSHVKHNKATGDNV 120 Query: 346 GP 351 GP Sbjct: 121 GP 122 >gb|EYU25019.1| hypothetical protein MIMGU_mgv1a016902mg [Mimulus guttatus] Length = 102 Score = 125 bits (313), Expect = 8e-27 Identities = 56/70 (80%), Positives = 64/70 (91%) Frame = +1 Query: 142 ARGRVSVLVRAEAINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKH 321 A+ R V VRAEAINP+IRK+E+KVVDSV+V+EL+KPLTAYCRCWRS TFPLCDG HVKH Sbjct: 27 AKPRRMVAVRAEAINPDIRKTEDKVVDSVVVTELAKPLTAYCRCWRSGTFPLCDGSHVKH 86 Query: 322 NKATGDNVGP 351 NKATGDN+GP Sbjct: 87 NKATGDNIGP 96 >ref|XP_002318867.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] gi|222859540|gb|EEE97087.1| hypothetical protein POPTR_0012s14230g [Populus trichocarpa] Length = 107 Score = 125 bits (313), Expect = 8e-27 Identities = 61/72 (84%), Positives = 65/72 (90%), Gaps = 2/72 (2%) Frame = +1 Query: 142 ARGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHV 315 AR R V+VRAEA INPEIRK+EEKVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HV Sbjct: 28 ARPRSLVVVRAEAQAINPEIRKTEEKVVDSVMVAELSKPLTAYCRCWRSGTFPLCDGSHV 87 Query: 316 KHNKATGDNVGP 351 KHNKATGDNVGP Sbjct: 88 KHNKATGDNVGP 99 >emb|CBI24493.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 123 bits (309), Expect = 2e-26 Identities = 56/67 (83%), Positives = 62/67 (92%) Frame = +1 Query: 151 RVSVLVRAEAINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKA 330 R +V+VRAE INPEIRK EEKVVDSV+V+EL+KP+TAYCRCWRS TFPLCDG HVKHNKA Sbjct: 26 RRAVVVRAETINPEIRKIEEKVVDSVLVAELAKPVTAYCRCWRSGTFPLCDGSHVKHNKA 85 Query: 331 TGDNVGP 351 TGDNVGP Sbjct: 86 TGDNVGP 92 >gb|EPS66502.1| hypothetical protein M569_08279 [Genlisea aurea] Length = 99 Score = 122 bits (307), Expect = 4e-26 Identities = 55/67 (82%), Positives = 61/67 (91%) Frame = +1 Query: 151 RVSVLVRAEAINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKA 330 R +V VRAE+INP+IRKSEEKVVDSV+V+EL KP+TAYCRCWRS TFPLCDG HVKHNK Sbjct: 27 RRTVAVRAESINPDIRKSEEKVVDSVVVAELGKPVTAYCRCWRSGTFPLCDGSHVKHNKG 86 Query: 331 TGDNVGP 351 TGDNVGP Sbjct: 87 TGDNVGP 93 >gb|EXC20884.1| CDGSH iron-sulfur domain-containing protein 2A [Morus notabilis] Length = 117 Score = 122 bits (305), Expect = 7e-26 Identities = 58/66 (87%), Positives = 61/66 (92%), Gaps = 2/66 (3%) Frame = +1 Query: 160 VLVRAE--AINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKAT 333 V+VRAE AINPEIRKSEEKVVDSV+V+ELSKPLT YCRCWRS TFPLCDG HVKHNKAT Sbjct: 46 VVVRAEGQAINPEIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGSHVKHNKAT 105 Query: 334 GDNVGP 351 GDNVGP Sbjct: 106 GDNVGP 111 >ref|XP_003548239.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Glycine max] Length = 113 Score = 122 bits (305), Expect = 7e-26 Identities = 59/71 (83%), Positives = 63/71 (88%), Gaps = 2/71 (2%) Frame = +1 Query: 145 RGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVK 318 R R VLV+AEA INP+IRKSEEKVVDSV+V+ELSKPLT YCRCWRS TFPLCDG HVK Sbjct: 38 RPRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGSHVK 97 Query: 319 HNKATGDNVGP 351 HNKATGDNVGP Sbjct: 98 HNKATGDNVGP 108 >ref|NP_001235168.1| uncharacterized protein LOC100306446 [Glycine max] gi|255628565|gb|ACU14627.1| unknown [Glycine max] Length = 113 Score = 122 bits (305), Expect = 7e-26 Identities = 59/71 (83%), Positives = 63/71 (88%), Gaps = 2/71 (2%) Frame = +1 Query: 145 RGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVK 318 R R VLV+AEA INP+IRKSEEKVVDSV+V+ELSKPLT YCRCWRS TFPLCDG HVK Sbjct: 38 RTRRVVLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPLTPYCRCWRSGTFPLCDGSHVK 97 Query: 319 HNKATGDNVGP 351 HNKATGDNVGP Sbjct: 98 HNKATGDNVGP 108 >ref|XP_006348049.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum tuberosum] Length = 98 Score = 121 bits (303), Expect = 1e-25 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = +1 Query: 142 ARGRVSVLVRAEAINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKH 321 A+ R V+VRA+AINP+I+K E KVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HVKH Sbjct: 23 AKPRRMVVVRAQAINPDIKKDEAKVVDSVLVTELSKPLTAYCRCWRSGTFPLCDGSHVKH 82 Query: 322 NKATGDNVGP 351 NK TGDNVGP Sbjct: 83 NKETGDNVGP 92 >ref|XP_004234151.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Solanum lycopersicum] Length = 98 Score = 121 bits (303), Expect = 1e-25 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = +1 Query: 142 ARGRVSVLVRAEAINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKH 321 A+ R V+VRA+AINP+I+K E KVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HVKH Sbjct: 23 AKPRRVVMVRAQAINPDIKKDEAKVVDSVLVTELSKPLTAYCRCWRSGTFPLCDGSHVKH 82 Query: 322 NKATGDNVGP 351 NK TGDNVGP Sbjct: 83 NKETGDNVGP 92 >ref|XP_007152388.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] gi|561025697|gb|ESW24382.1| hypothetical protein PHAVU_004G125800g [Phaseolus vulgaris] Length = 111 Score = 119 bits (299), Expect = 3e-25 Identities = 57/71 (80%), Positives = 63/71 (88%), Gaps = 2/71 (2%) Frame = +1 Query: 145 RGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVK 318 R R +LV+AEA INP+IRKSEEKVVDSV+V+ELSKP+ AYCRCWRS TFPLCDG HVK Sbjct: 36 RPRRVMLVKAEAVSINPDIRKSEEKVVDSVVVTELSKPVNAYCRCWRSGTFPLCDGSHVK 95 Query: 319 HNKATGDNVGP 351 HNKATGDNVGP Sbjct: 96 HNKATGDNVGP 106 >ref|XP_006421772.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] gi|557523645|gb|ESR35012.1| hypothetical protein CICLE_v10006560mg, partial [Citrus clementina] Length = 198 Score = 119 bits (299), Expect = 3e-25 Identities = 67/114 (58%), Positives = 78/114 (68%), Gaps = 2/114 (1%) Frame = +1 Query: 16 VTMASVVSMVGCSRSFSMESLNKNRRGSLGXXXXXXXXXXXXARGRVSVLVRAEA--INP 189 V+MAS+V + CS + NK+ + AR R V+VRAE IN Sbjct: 91 VSMASIV--MSCSATVPGFRFNKSPMAA----------GVVTARPRRVVVVRAEGQGINL 138 Query: 190 EIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNVGP 351 +IRK+EEKVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HVKHNKATGDNVGP Sbjct: 139 DIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHVKHNKATGDNVGP 192 >ref|XP_004506290.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2A-like [Cicer arietinum] Length = 122 Score = 119 bits (299), Expect = 3e-25 Identities = 66/118 (55%), Positives = 78/118 (66%), Gaps = 8/118 (6%) Frame = +1 Query: 22 MASVVSMVGCSRSFSMESLNKNRRGSLGXXXXXXXXXXXXA---RGRVSVLVRAE----- 177 M SV+S VG + L + +RG +G R R V+V+AE Sbjct: 1 MESVLSQVGVV-FYQKTQLIERKRGIIGTNFNTCSFGIGGVDVKRVRSMVVVKAETGGVN 59 Query: 178 AINPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNVGP 351 +INP+IRK+EEKVVDSV+V+ELSKPLT YCRCWRS TFPLCDG HVKHNKATGDNVGP Sbjct: 60 SINPDIRKNEEKVVDSVLVNELSKPLTPYCRCWRSGTFPLCDGSHVKHNKATGDNVGP 117 >ref|XP_006490265.1| PREDICTED: CDGSH iron-sulfur domain-containing protein NEET-like [Citrus sinensis] Length = 130 Score = 119 bits (297), Expect = 6e-25 Identities = 58/72 (80%), Positives = 63/72 (87%), Gaps = 2/72 (2%) Frame = +1 Query: 142 ARGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHV 315 AR R V+VRAE IN +IRK+EEKVVDSV+V+ELSKPLTAYCRCWRS TFPLCDG HV Sbjct: 53 ARPRRVVVVRAEGQGINLDIRKTEEKVVDSVVVTELSKPLTAYCRCWRSGTFPLCDGSHV 112 Query: 316 KHNKATGDNVGP 351 KHNKATGDNVGP Sbjct: 113 KHNKATGDNVGP 124 >ref|XP_004308153.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2A-like [Fragaria vesca subsp. vesca] Length = 123 Score = 118 bits (295), Expect = 1e-24 Identities = 64/118 (54%), Positives = 74/118 (62%), Gaps = 8/118 (6%) Frame = +1 Query: 22 MASVVSMVGCS------RSFSMESLNKNRRGSLGXXXXXXXXXXXXARGRVSVLVRAEA- 180 MAS+++ G + S SL R + G R R +VRAE Sbjct: 1 MASIITTAGLALPGYTKSSVPGSSLGSTRATTFGTHRVAYSSGVDFGR-RTKTVVRAEVQ 59 Query: 181 -INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNKATGDNVGP 351 +NPEIRKSE KVVDSV+V+EL+KPLTAYCRCWRS TFPLCDG HVKHNKA GDNVGP Sbjct: 60 PLNPEIRKSEAKVVDSVVVTELAKPLTAYCRCWRSGTFPLCDGSHVKHNKAAGDNVGP 117 >ref|XP_002510894.1| conserved hypothetical protein [Ricinus communis] gi|223550009|gb|EEF51496.1| conserved hypothetical protein [Ricinus communis] Length = 111 Score = 118 bits (295), Expect = 1e-24 Identities = 57/72 (79%), Positives = 61/72 (84%), Gaps = 2/72 (2%) Frame = +1 Query: 142 ARGRVSVLVRAEA--INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHV 315 A+ R + VRAEA INP IRK EEKVVDSV+V+ELSKPLT YCRCWRS TFPLCDG HV Sbjct: 32 AKPRRMIAVRAEAQGINPAIRKDEEKVVDSVMVAELSKPLTPYCRCWRSGTFPLCDGSHV 91 Query: 316 KHNKATGDNVGP 351 KHNKATGDNVGP Sbjct: 92 KHNKATGDNVGP 103 >gb|AFK46198.1| unknown [Lotus japonicus] Length = 118 Score = 117 bits (292), Expect = 2e-24 Identities = 54/68 (79%), Positives = 61/68 (89%), Gaps = 4/68 (5%) Frame = +1 Query: 160 VLVRAEA----INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKHVKHNK 327 VLV+AEA INP+IRK+E KVVDSV+++EL+KPLTAYCRCWRS TFPLCDG HVKHNK Sbjct: 46 VLVKAEAEGVGINPDIRKTEAKVVDSVVITELAKPLTAYCRCWRSGTFPLCDGSHVKHNK 105 Query: 328 ATGDNVGP 351 ATGDNVGP Sbjct: 106 ATGDNVGP 113 >ref|XP_004143713.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] gi|449506515|ref|XP_004162771.1| PREDICTED: CDGSH iron-sulfur domain-containing protein 2-like [Cucumis sativus] Length = 108 Score = 115 bits (288), Expect = 6e-24 Identities = 56/73 (76%), Positives = 60/73 (82%), Gaps = 6/73 (8%) Frame = +1 Query: 151 RVSVLVRAEA------INPEIRKSEEKVVDSVIVSELSKPLTAYCRCWRSATFPLCDGKH 312 R +V+VRAE INP IRKSE+KVVDSV+V ELSKPLT YCRCWRS TFPLCDG H Sbjct: 31 RRTVVVRAEGGSSGEHINPAIRKSEDKVVDSVLVPELSKPLTPYCRCWRSGTFPLCDGSH 90 Query: 313 VKHNKATGDNVGP 351 VKHNKATGDNVGP Sbjct: 91 VKHNKATGDNVGP 103