BLASTX nr result
ID: Paeonia25_contig00031492
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031492 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL98738.1| predicted protein [Fibroporia radiculosa] 61 2e-07 >emb|CCL98738.1| predicted protein [Fibroporia radiculosa] Length = 772 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +2 Query: 158 MAQTLNDQLYSRGPELPRGRTPMPEPDTGPLGFVMPHPPSSNRSPLTPSQGPDWSPWALL 337 MA+ L+DQ+ RGR+P P + P GF MPH P S P+ P QGPDW+PWA + Sbjct: 69 MARNLDDQMSQEAYH--RGRSPAPHLNPSP-GFAMPHRPHSRGPPVPPQQGPDWTPWAPV 125 Query: 338 Q-HQS 349 Q HQ+ Sbjct: 126 QPHQA 130