BLASTX nr result
ID: Paeonia25_contig00031355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031355 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [T... 67 3e-09 ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobr... 67 3e-09 ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 m... 66 6e-09 ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 m... 66 6e-09 ref|XP_004230404.1| PREDICTED: germin-like protein subfamily 1 m... 66 6e-09 ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 m... 65 7e-09 ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 m... 65 7e-09 ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 m... 65 7e-09 ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1-... 65 7e-09 gb|AFW90592.1| germin-like protein subfamily 1 member 20 precurs... 65 7e-09 ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-... 64 3e-08 ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-... 63 4e-08 ref|XP_002284212.1| PREDICTED: germin-like protein subfamily 1 m... 63 4e-08 emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera] 62 6e-08 ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 m... 62 8e-08 ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 m... 62 8e-08 ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 m... 62 8e-08 ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobr... 61 1e-07 ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform... 61 1e-07 ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform... 61 1e-07 >ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao] gi|508718883|gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao] Length = 476 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 SNPPIN DVLTKAFQ+DK V+ YLQSQFWWDNN Sbjct: 444 SNPPINPDVLTKAFQLDKNVVKYLQSQFWWDNN 476 >ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao] gi|590641619|ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao] gi|508718881|gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao] gi|508718887|gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao] Length = 225 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 SNPPIN DVLTKAFQ+DK V+ YLQSQFWWDNN Sbjct: 193 SNPPINPDVLTKAFQLDKNVVKYLQSQFWWDNN 225 >ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum tuberosum] Length = 228 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQVDKKVVDYLQSQFWWDNN 228 >ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum tuberosum] Length = 228 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQVDKKVVDYLQSQFWWDNN 228 >ref|XP_004230404.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum lycopersicum] Length = 228 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQVDKKVVHYLQSQFWWDNN 228 >ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum tuberosum] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN D+L KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDILAKAFQVDKKVVDYLQSQFWWDNN 228 >ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum tuberosum] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN D+L KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDILAKAFQVDKKVVDYLQSQFWWDNN 228 >ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum lycopersicum] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQ+DKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQIDKKVVDYLQSQFWWDNN 228 >ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1-like [Solanum lycopersicum] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQ+DKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQIDKKVVDYLQSQFWWDNN 228 >gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum tuberosum] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN D+L KAFQVDKKV++YLQSQFWWDNN Sbjct: 196 SDPPINDDILAKAFQVDKKVVDYLQSQFWWDNN 228 >ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum] gi|565365114|ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum] Length = 228 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPI+ DVL KAFQ+DKKV++YLQSQFWWDNN Sbjct: 196 SDPPISDDVLAKAFQIDKKVVDYLQSQFWWDNN 228 >ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum] Length = 228 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+P IN DVL KAFQV+KKV+NYLQSQFWWDNN Sbjct: 196 SDPSINNDVLAKAFQVEKKVVNYLQSQFWWDNN 228 >ref|XP_002284212.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Vitis vinifera] Length = 225 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPI++DVLTKAFQ+DK V+N+LQS FWWDNN Sbjct: 193 SDPPISIDVLTKAFQLDKDVVNFLQSSFWWDNN 225 >emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera] Length = 224 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDN 247 S+PPI++DVLTKAFQ+DK V+NYLQS FWWDN Sbjct: 193 SDPPISIDVLTKAFQLDKDVVNYLQSSFWWDN 224 >ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum tuberosum] Length = 228 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQ++ KV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQIENKVVDYLQSQFWWDNN 228 >ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum tuberosum] Length = 228 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQ++ KV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQIENKVVDYLQSQFWWDNN 228 >ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum tuberosum] Length = 228 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 S+PPIN DVL KAFQ++ KV++YLQSQFWWDNN Sbjct: 196 SDPPINDDVLAKAFQIENKVVDYLQSQFWWDNN 228 >ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao] gi|508718889|gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao] Length = 226 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 SNPPIN DVLTKAFQ+DK ++ LQS+FWWDNN Sbjct: 194 SNPPINPDVLTKAFQLDKNIVTSLQSRFWWDNN 226 >ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao] gi|508718886|gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao] Length = 226 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 SNPPIN DVLTKAFQ+DK ++ LQS+FWWDNN Sbjct: 194 SNPPINPDVLTKAFQLDKNIVTSLQSRFWWDNN 226 >ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao] gi|508718885|gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao] Length = 226 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -3 Query: 342 SNPPINVDVLTKAFQVDKKVINYLQSQFWWDNN 244 SNPPIN DVLTKAFQ+DK ++ LQS+FWWDNN Sbjct: 194 SNPPINPDVLTKAFQLDKNIVTSLQSRFWWDNN 226