BLASTX nr result
ID: Paeonia25_contig00031349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031349 (795 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007367870.1| hypothetical protein DICSQDRAFT_181976 [Dich... 59 3e-06 >ref|XP_007367870.1| hypothetical protein DICSQDRAFT_181976 [Dichomitus squalens LYAD-421 SS1] gi|395326883|gb|EJF59287.1| hypothetical protein DICSQDRAFT_181976 [Dichomitus squalens LYAD-421 SS1] Length = 369 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/72 (37%), Positives = 44/72 (61%) Frame = +1 Query: 118 TYGTMRLSRSTSINANFSTILLRAGVLYFSVMFTMNVADLIQYLTMGSSIVNTFLTTFNY 297 TY T L+R N+ST++LR G LYF + +NV ++ + +GS+++N + Sbjct: 193 TYRTHVLTRGVDFRTNYSTLILRDGTLYFLAVCFLNVIAIVYVMNIGSNLLNDMIVALGS 252 Query: 298 LLISHFLLSLQD 333 LL+S FLL+L+D Sbjct: 253 LLMSRFLLNLRD 264