BLASTX nr result
ID: Paeonia25_contig00031153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031153 (613 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW63382.1| hypothetical protein TRAVEDRAFT_56411 [Trametes v... 63 8e-08 gb|EMD37352.1| hypothetical protein CERSUDRAFT_114029 [Ceriporio... 59 1e-06 gb|EPT05025.1| hypothetical protein FOMPIDRAFT_1139946 [Fomitops... 56 9e-06 >gb|EIW63382.1| hypothetical protein TRAVEDRAFT_56411 [Trametes versicolor FP-101664 SS1] Length = 673 Score = 62.8 bits (151), Expect = 8e-08 Identities = 32/71 (45%), Positives = 40/71 (56%) Frame = +1 Query: 7 LVQRGLRALGLSTHQLSFPALARTSAXXXXXXXWTYELRSSAHPDAVQKSWGELLVEQSP 186 L++ R GL + + + A AR S W +LR S HPD VQK G LLVE+SP Sbjct: 582 LLESRARTFGLDSGEGADGATARKSGRRARVRRWVCDLRPSGHPDVVQKGLGALLVERSP 641 Query: 187 AGEETRFLGFC 219 AGEE R + FC Sbjct: 642 AGEEARLMAFC 652 >gb|EMD37352.1| hypothetical protein CERSUDRAFT_114029 [Ceriporiopsis subvermispora B] Length = 617 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = +1 Query: 106 WTYELRSSAHPDAVQKSWGELLVEQSPAGEETRFLGFC 219 W +LR S HPD VQK WG+LL+E+ PAGEE R L FC Sbjct: 549 WVCDLRPSGHPDVVQKGWGQLLLEKGPAGEEVRLLVFC 586 >gb|EPT05025.1| hypothetical protein FOMPIDRAFT_1139946 [Fomitopsis pinicola FP-58527 SS1] Length = 558 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/38 (65%), Positives = 28/38 (73%) Frame = +1 Query: 106 WTYELRSSAHPDAVQKSWGELLVEQSPAGEETRFLGFC 219 W YELR S HPDAV+K GELL+E+S AGEE R L C Sbjct: 495 WLYELRPSGHPDAVKKGVGELLLERSQAGEEARLLALC 532