BLASTX nr result
ID: Paeonia25_contig00031051
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00031051 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW57035.1| hypothetical protein TRAVEDRAFT_73301 [Trametes v... 63 4e-08 >gb|EIW57035.1| hypothetical protein TRAVEDRAFT_73301 [Trametes versicolor FP-101664 SS1] Length = 416 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 115 HRLAGEHRDCVCFADARYQLAVAYQEARDYWARHPED 5 +RLA +H DC C+ D R QLAVA+QEARDYWARHP+D Sbjct: 35 NRLAPKHTDCPCYVDPRCQLAVAFQEARDYWARHPDD 71