BLASTX nr result
ID: Paeonia25_contig00029915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029915 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002629453.1| hypothetical protein BDBG_00699 [Ajellomyces... 55 8e-06 >ref|XP_002629453.1| hypothetical protein BDBG_00699 [Ajellomyces dermatitidis SLH14081] gi|239587238|gb|EEQ69881.1| hypothetical protein BDBG_00699 [Ajellomyces dermatitidis SLH14081] Length = 288 Score = 55.5 bits (132), Expect = 8e-06 Identities = 34/93 (36%), Positives = 40/93 (43%), Gaps = 7/93 (7%) Frame = +3 Query: 33 DDDPTPRPIQRIANMEPHNVSTSPSRPKIPSPGHHTVSRPTTPSNSASETRSRPVTPSAS 212 + +PTP P R P ST P+ P P P T + PT P + S T RP PS+ Sbjct: 125 EPEPTPTPTTREPPPSPSTPSTPPTPPPSPPPQRTTTTSPTPPQSRESRTPPRP-PPSSR 183 Query: 213 TSRLPRPSIAPGTR-------PPERQPPTPGKS 290 PRPS P TR P R P P S Sbjct: 184 ARSTPRPSPEPTTRPRSPTSTPTRRSTPPPSSS 216