BLASTX nr result
ID: Paeonia25_contig00029691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029691 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007010326.1| Catalytic, putative isoform 1 [Theobroma cac... 56 5e-06 ref|XP_002266006.1| PREDICTED: uncharacterized protein LOC100256... 56 6e-06 emb|CAN82520.1| hypothetical protein VITISV_042701 [Vitis vinifera] 56 6e-06 >ref|XP_007010326.1| Catalytic, putative isoform 1 [Theobroma cacao] gi|590566767|ref|XP_007010327.1| Catalytic, putative isoform 1 [Theobroma cacao] gi|508727239|gb|EOY19136.1| Catalytic, putative isoform 1 [Theobroma cacao] gi|508727240|gb|EOY19137.1| Catalytic, putative isoform 1 [Theobroma cacao] Length = 344 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 259 YHEIPGAGHLFPYADGMIETIIKSLLLGEK 170 YHE+PGAGHLFPYADGM E II++LL+G+K Sbjct: 315 YHELPGAGHLFPYADGMSEAIIRALLVGQK 344 >ref|XP_002266006.1| PREDICTED: uncharacterized protein LOC100256822 isoform 1 [Vitis vinifera] gi|296087979|emb|CBI35262.3| unnamed protein product [Vitis vinifera] Length = 374 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 259 YHEIPGAGHLFPYADGMIETIIKSLLLGEK 170 YHE+PGAGHLFP ADGM + I+K+LLLGEK Sbjct: 345 YHEVPGAGHLFPIADGMTDVIVKALLLGEK 374 >emb|CAN82520.1| hypothetical protein VITISV_042701 [Vitis vinifera] Length = 385 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 259 YHEIPGAGHLFPYADGMIETIIKSLLLGEK 170 YHE+PGAGHLFP ADGM + I+K+LLLGEK Sbjct: 356 YHEVPGAGHLFPIADGMTDVIVKALLLGEK 385