BLASTX nr result
ID: Paeonia25_contig00029679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029679 (1397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207058.1| hypothetical protein PRUPE_ppa027179mg, part... 60 2e-06 ref|XP_004303138.1| PREDICTED: uncharacterized protein LOC101290... 59 5e-06 >ref|XP_007207058.1| hypothetical protein PRUPE_ppa027179mg, partial [Prunus persica] gi|462402700|gb|EMJ08257.1| hypothetical protein PRUPE_ppa027179mg, partial [Prunus persica] Length = 1239 Score = 60.5 bits (145), Expect = 2e-06 Identities = 32/52 (61%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 954 LCLNVYE-EAW*EAVIFDHDDESGEMRIFFLNLCDELKSRISKLRITLDRDK 802 LC++VY EAW E VIFDH+D S E RIFF +L DELK+RI LRIT + D+ Sbjct: 87 LCVDVYHLEAWWEGVIFDHEDGSEERRIFFPDLGDELKARIDTLRITHEWDE 138 >ref|XP_004303138.1| PREDICTED: uncharacterized protein LOC101290780 [Fragaria vesca subsp. vesca] Length = 375 Score = 58.9 bits (141), Expect = 5e-06 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 1/56 (1%) Frame = -3 Query: 954 LCLNVY-EEAW*EAVIFDHDDESGEMRIFFLNLCDELKSRISKLRITLDRDKAIGS 790 LC++ + +EAW E VIFDH+D S E IFF +L DELK+ I KLRIT D D+A S Sbjct: 86 LCVDYFLDEAWCEGVIFDHNDGSEERMIFFPDLGDELKTGIDKLRITQDWDEATDS 141