BLASTX nr result
ID: Paeonia25_contig00029542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029542 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385738.1| hypothetical protein POPTR_0003s11510g [Popu... 94 3e-17 ref|XP_004294382.1| PREDICTED: cullin-1-like [Fragaria vesca sub... 94 3e-17 gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia sub... 93 3e-17 ref|XP_004508284.1| PREDICTED: cullin-1-like [Cicer arietinum] 93 4e-17 ref|XP_003609639.1| Cullin-like protein1 [Medicago truncatula] g... 93 4e-17 gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus... 92 8e-17 gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus... 92 8e-17 gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] 92 8e-17 ref|XP_004309677.1| PREDICTED: cullin-1-like [Fragaria vesca sub... 92 8e-17 ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] 92 8e-17 ref|XP_002889430.1| hypothetical protein ARALYDRAFT_311398 [Arab... 92 8e-17 ref|XP_006444260.1| hypothetical protein CICLE_v10019010mg [Citr... 91 1e-16 ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prun... 91 1e-16 gb|AFW57653.1| hypothetical protein ZEAMMB73_453608 [Zea mays] 91 1e-16 gb|AFW57652.1| hypothetical protein ZEAMMB73_453608 [Zea mays] 91 1e-16 gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] 91 1e-16 ref|XP_002535238.1| conserved hypothetical protein [Ricinus comm... 91 1e-16 dbj|BAC42547.1| unknown protein [Arabidopsis thaliana] gi|300172... 91 2e-16 gb|AFW82617.1| hypothetical protein ZEAMMB73_584416 [Zea mays] 91 2e-16 ref|XP_003625883.1| Cullin-like protein1 [Medicago truncatula] g... 91 2e-16 >ref|XP_006385738.1| hypothetical protein POPTR_0003s11510g [Populus trichocarpa] gi|566162164|ref|XP_002303533.2| hypothetical protein POPTR_0003s11510g [Populus trichocarpa] gi|550342977|gb|ERP63535.1| hypothetical protein POPTR_0003s11510g [Populus trichocarpa] gi|550342978|gb|EEE78512.2| hypothetical protein POPTR_0003s11510g [Populus trichocarpa] Length = 738 Score = 93.6 bits (231), Expect = 3e-17 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 K+P P V KK++E+ + DR+YAID A++RIMK+ +V+G+ +LV +C+E L + FK Sbjct: 649 KVPLPLVDERKKVVEDVDK---DRRYAIDAAIVRIMKSRKVLGHQQLVLECVEQLNLMFK 705 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 706 PDIKAIKKRIEDLISRDYLERDKENPNMFKYLA 738 >ref|XP_004294382.1| PREDICTED: cullin-1-like [Fragaria vesca subsp. vesca] Length = 741 Score = 93.6 bits (231), Expect = 3e-17 Identities = 44/91 (48%), Positives = 68/91 (74%) Frame = -1 Query: 375 IPPRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFKPD 196 +PP V +KK+ E+ + +RKYAID A++RIMK+ +++G+ +LV +C+E+++ FKPD Sbjct: 654 LPPLVDEKKKVTEDVEK---ERKYAIDAAIVRIMKSRKILGHQKLVMECVEMVQHVFKPD 710 Query: 195 SKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 K IK RI++LI RDY+ERD+ D + KYVA Sbjct: 711 IKAIKKRIEDLISRDYLERDQEDSNTFKYVA 741 >gb|ABB77428.1| cullin 1-like protein C [Petunia integrifolia subsp. inflata] Length = 742 Score = 93.2 bits (230), Expect = 3e-17 Identities = 49/93 (52%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY ELV +C+E L FK Sbjct: 653 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQELVMECVEQLGRMFK 709 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 710 PDVKAIKKRIEDLITRDYLERDKDNPNLFKYLA 742 >ref|XP_004508284.1| PREDICTED: cullin-1-like [Cicer arietinum] Length = 744 Score = 92.8 bits (229), Expect = 4e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 655 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 712 PDVKAIKKRIEDLISRDYLERDKENPNMFKYLA 744 >ref|XP_003609639.1| Cullin-like protein1 [Medicago truncatula] gi|355510694|gb|AES91836.1| Cullin-like protein1 [Medicago truncatula] Length = 929 Score = 92.8 bits (229), Expect = 4e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 840 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 896 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 897 PDVKAIKKRIEDLISRDYLERDKENPNMFKYLA 929 >gb|EYU45565.1| hypothetical protein MIMGU_mgv1a001885mg [Mimulus guttatus] Length = 744 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 655 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 712 PDVKAIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >gb|EYU43928.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] gi|604345347|gb|EYU43929.1| hypothetical protein MIMGU_mgv1a001887mg [Mimulus guttatus] Length = 744 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 655 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 712 PDVKAIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >gb|EPS73417.1| hypothetical protein M569_01333 [Genlisea aurea] Length = 744 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 655 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 712 PDVKAIKKRIEDLITRDYLERDKDNPNLFKYLA 744 >ref|XP_004309677.1| PREDICTED: cullin-1-like [Fragaria vesca subsp. vesca] Length = 738 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V KK+IE+ + DR+YAID A++RIMK+ +V+G+ +LV +C+E L FK Sbjct: 649 KIPLPPVDERKKVIEDVDK---DRRYAIDAAIVRIMKSRKVLGHQQLVMECVEQLGRMFK 705 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P + KY+A Sbjct: 706 PDIKAIKKRIEDLITRDYLERDKENPNTFKYLA 738 >ref|XP_004229226.1| PREDICTED: cullin-1-like [Solanum lycopersicum] Length = 742 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK+IE+ + DR+YAID +++RIMK+ +V+GY +LV +C+E L FK Sbjct: 653 KIPLPPVDEKKKVIEDVDK---DRRYAIDASIVRIMKSRKVLGYQQLVMECVEQLGRMFK 709 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 710 PDVKAIKKRIEDLITRDYLERDKDNPNLFKYLA 742 >ref|XP_002889430.1| hypothetical protein ARALYDRAFT_311398 [Arabidopsis lyrata subsp. lyrata] gi|297335272|gb|EFH65689.1| hypothetical protein ARALYDRAFT_311398 [Arabidopsis lyrata subsp. lyrata] Length = 739 Score = 92.0 bits (227), Expect = 8e-17 Identities = 48/92 (52%), Positives = 67/92 (72%), Gaps = 4/92 (4%) Frame = -1 Query: 366 RVPM----EKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFKP 199 RVP+ E+K + E V+ DR+YAID AL+RIMK+ +V+G+ +LV++C+E L FKP Sbjct: 650 RVPLPPMDERKKVVEDVDK--DRRYAIDAALVRIMKSRKVLGHQQLVSECVEHLSKMFKP 707 Query: 198 DSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 D K IK RI++LI RDY+ERD +P + KYVA Sbjct: 708 DIKMIKKRIEDLISRDYLERDSENPNTFKYVA 739 >ref|XP_006444260.1| hypothetical protein CICLE_v10019010mg [Citrus clementina] gi|568852469|ref|XP_006479898.1| PREDICTED: cullin-1-like [Citrus sinensis] gi|557546522|gb|ESR57500.1| hypothetical protein CICLE_v10019010mg [Citrus clementina] Length = 738 Score = 91.3 bits (225), Expect = 1e-16 Identities = 46/93 (49%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V KK++E+ + DR+YAID AL+RIMK+ +V+G+ +LV++C+E L FK Sbjct: 649 KIPLPPVDERKKIVEDVDK---DRRYAIDAALVRIMKSRKVLGHQQLVSECVEQLSRMFK 705 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK R+++LI RDY+ERD+ +P +Y+A Sbjct: 706 PDIKAIKKRMEDLITRDYLERDKENPNMFRYLA 738 >ref|XP_007198998.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] gi|462394398|gb|EMJ00197.1| hypothetical protein PRUPE_ppa001948mg [Prunus persica] Length = 738 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/93 (51%), Positives = 67/93 (72%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V KK+IE+ + DR+YAID A++RIMK+ +V+G+ +LV +C+E L FK Sbjct: 649 KIPLPPVDERKKVIEDVDK---DRRYAIDAAIVRIMKSRKVLGHQQLVMECVEQLGRMFK 705 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 706 PDIKAIKKRIEDLITRDYLERDKENPNMFKYLA 738 >gb|AFW57653.1| hypothetical protein ZEAMMB73_453608 [Zea mays] Length = 744 Score = 91.3 bits (225), Expect = 1e-16 Identities = 47/93 (50%), Positives = 69/93 (74%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK++E+ + DR+YAID +++RIMK+ +VMG+ +LVA+C+E L FK Sbjct: 655 KIPLPPVDEKKKVVEDVDK---DRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ + + KY+A Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 744 >gb|AFW57652.1| hypothetical protein ZEAMMB73_453608 [Zea mays] Length = 739 Score = 91.3 bits (225), Expect = 1e-16 Identities = 47/93 (50%), Positives = 69/93 (74%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V +KK++E+ + DR+YAID +++RIMK+ +VMG+ +LVA+C+E L FK Sbjct: 650 KIPLPPVDEKKKVVEDVDK---DRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFK 706 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ + + KY+A Sbjct: 707 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 739 >gb|AFJ21664.1| cullin 1-like protein A [Prunus avium] Length = 738 Score = 91.3 bits (225), Expect = 1e-16 Identities = 48/93 (51%), Positives = 67/93 (72%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V KK+IE+ + DR+YAID A++RIMK+ +V+G+ +LV +C+E L FK Sbjct: 649 KIPLPPVDERKKVIEDVDK---DRRYAIDAAIVRIMKSRKVLGHQQLVMECVEQLGRMFK 705 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P KY+A Sbjct: 706 PDIKAIKKRIEDLITRDYLERDKENPNMFKYLA 738 >ref|XP_002535238.1| conserved hypothetical protein [Ricinus communis] gi|223523678|gb|EEF27144.1| conserved hypothetical protein [Ricinus communis] Length = 211 Score = 91.3 bits (225), Expect = 1e-16 Identities = 45/92 (48%), Positives = 68/92 (73%) Frame = -1 Query: 378 KIPPRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFKP 199 KIP V E+K + E V+ DR+YAID A++RIMK+ +V+G+ +LV++C+E L FKP Sbjct: 122 KIPLPVVDERKKVVEDVDK--DRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKP 179 Query: 198 DSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 D K IK R+++LI RDY+ERD+ +P + +Y+A Sbjct: 180 DIKAIKKRMEDLITRDYLERDKENPNTFRYLA 211 >dbj|BAC42547.1| unknown protein [Arabidopsis thaliana] gi|30017293|gb|AAP12880.1| At1g02980 [Arabidopsis thaliana] Length = 268 Score = 90.9 bits (224), Expect = 2e-16 Identities = 48/92 (52%), Positives = 67/92 (72%), Gaps = 4/92 (4%) Frame = -1 Query: 366 RVPM----EKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFKP 199 RVP+ E+K I E V+ DR+YAID AL+RIMK+ +V+G+ +LV++C+E L FKP Sbjct: 179 RVPLPPMDERKKIVEDVDK--DRRYAIDAALVRIMKSRKVLGHQQLVSECVEHLSKMFKP 236 Query: 198 DSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 D K IK RI++LI RDY+ERD +P + KY+A Sbjct: 237 DIKMIKKRIEDLISRDYLERDTDNPNTFKYLA 268 >gb|AFW82617.1| hypothetical protein ZEAMMB73_584416 [Zea mays] Length = 744 Score = 90.9 bits (224), Expect = 2e-16 Identities = 46/93 (49%), Positives = 69/93 (74%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 K+P P V +KK++E+ + DR+YAID +++RIMK+ +VMG+ +LVA+C+E L FK Sbjct: 655 KVPLPPVDEKKKVVEDVDK---DRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFK 711 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ + + KY+A Sbjct: 712 PDFKAIKKRIEDLITRDYLERDKDNANTYKYLA 744 >ref|XP_003625883.1| Cullin-like protein1 [Medicago truncatula] gi|355500898|gb|AES82101.1| Cullin-like protein1 [Medicago truncatula] Length = 728 Score = 90.9 bits (224), Expect = 2e-16 Identities = 47/93 (50%), Positives = 68/93 (73%), Gaps = 1/93 (1%) Frame = -1 Query: 378 KIP-PRVPMEKKLIEEAVETSLDRKYAIDCALLRIMKASRVMGYTELVAKCIELLKIKFK 202 KIP P V KK+IE+ + DR+YAID A++RIMK+ +V+G+ +LV +C+E L FK Sbjct: 639 KIPLPPVDERKKVIEDVDK---DRRYAIDAAIVRIMKSRKVLGHQQLVLECVEQLGRMFK 695 Query: 201 PDSKTIKARIDNLIDRDYMERDETDPCSLKYVA 103 PD K IK RI++LI RDY+ERD+ +P + +Y+A Sbjct: 696 PDIKAIKKRIEDLITRDYLERDKENPNTFRYLA 728