BLASTX nr result
ID: Paeonia25_contig00029508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029508 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533480.1| conserved hypothetical protein [Ricinus comm... 60 3e-07 >ref|XP_002533480.1| conserved hypothetical protein [Ricinus communis] gi|223526673|gb|EEF28912.1| conserved hypothetical protein [Ricinus communis] Length = 65 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/68 (44%), Positives = 42/68 (61%) Frame = +2 Query: 50 MNVHSILIFCSSIPLVNCVLVPLILYFPSSELAISSKSTQEEEKDEVATLLNRAAQNHFR 229 MN+ + + CSS+PL+ CV+ L+L F S E + S + ++ A NRAAQ HFR Sbjct: 1 MNLRQVTVVCSSLPLLGCVVASLLLLFTSDEPSSSDSGSMVNDE---AVSNNRAAQKHFR 57 Query: 230 QLQNIRGA 253 Q+Q IRGA Sbjct: 58 QIQQIRGA 65