BLASTX nr result
ID: Paeonia25_contig00029292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00029292 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM00214.1| predicted protein [Fibroporia radiculosa] 56 5e-06 >emb|CCM00214.1| predicted protein [Fibroporia radiculosa] Length = 283 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/42 (69%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +1 Query: 67 MSSPFATYPVPERSFMPSNPSSSRGAAP-SRGTGAKRGRKPK 189 M+SPFATYP PER+F+ SRG AP +RGTGAKRGRKPK Sbjct: 1 MTSPFATYPAPERTFI-----QSRGGAPATRGTGAKRGRKPK 37