BLASTX nr result
ID: Paeonia25_contig00027583
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027583 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007367819.1| hypothetical protein DICSQDRAFT_65039 [Dicho... 57 2e-06 >ref|XP_007367819.1| hypothetical protein DICSQDRAFT_65039 [Dichomitus squalens LYAD-421 SS1] gi|395327037|gb|EJF59440.1| hypothetical protein DICSQDRAFT_65039 [Dichomitus squalens LYAD-421 SS1] Length = 661 Score = 57.4 bits (137), Expect = 2e-06 Identities = 35/88 (39%), Positives = 45/88 (51%), Gaps = 26/88 (29%) Frame = +1 Query: 55 ASTWPDLWRVYEEACVLCASV------------LYAGGSPFPSNARSAGAGAIRLEGED- 195 +STW D+WRVYE+ CV+CA + Y G +P S G G+IRLEG+D Sbjct: 385 SSTWTDVWRVYEDVCVMCAGLWMGAWRNGNLGPSYPGTTPRRSANWGTGTGSIRLEGDDE 444 Query: 196 ------------TLGLGV-GRKKGSTST 240 TLG+G+ GR GS ST Sbjct: 445 LNARTRSAPSVRTLGMGIEGRPSGSGST 472