BLASTX nr result
ID: Paeonia25_contig00027531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027531 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277259.1| PREDICTED: protein IQ-DOMAIN 31-like [Vitis ... 61 2e-07 ref|XP_007046195.1| IQ-domain 28, putative isoform 1 [Theobroma ... 59 5e-07 >ref|XP_002277259.1| PREDICTED: protein IQ-DOMAIN 31-like [Vitis vinifera] Length = 646 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 SLSPRIQRLAQATGKGGIRTEKSLLSSRDSQEKVTHAEWRR 123 S+SPR+QRL QA+GKGG + ++SLLSSRD EKV EWRR Sbjct: 606 SMSPRVQRLVQASGKGGSKNDRSLLSSRDCHEKVVQTEWRR 646 >ref|XP_007046195.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|590700564|ref|XP_007046196.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|590700568|ref|XP_007046197.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|590700572|ref|XP_007046198.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|508710130|gb|EOY02027.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|508710131|gb|EOY02028.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|508710132|gb|EOY02029.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] gi|508710133|gb|EOY02030.1| IQ-domain 28, putative isoform 1 [Theobroma cacao] Length = 563 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +1 Query: 1 SLSPRIQRLAQATGKGGIRTEKSLLSSRDSQEKVTHAEWRR 123 SLSPR QRL Q GKG IR EKSL SSRD+ +KV AEW+R Sbjct: 523 SLSPRAQRLVQVAGKGAIRNEKSLSSSRDANDKVVRAEWKR 563