BLASTX nr result
ID: Paeonia25_contig00027528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00027528 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESK88070.1| cytochrome p450 [Moniliophthora roreri MCA 2997] 55 1e-05 >gb|ESK88070.1| cytochrome p450 [Moniliophthora roreri MCA 2997] Length = 578 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/70 (35%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Frame = -1 Query: 314 ILKGLVFYLLARFVWGATRNLIFGSPFDNIPGPAPETWLTGS---IFGRSGLTFQQRWLE 144 IL ++Y+ RF + IF SP ++PGP P++W G+ +F GL F Q ++ Sbjct: 17 ILDLCIYYITVRFFIWVAKPFIFTSPLSHLPGPPPQSWFKGNLGQLFNAKGLPFHQSLVD 76 Query: 143 DHGGVSRVKG 114 D+GG+ +V G Sbjct: 77 DYGGMVKVYG 86