BLASTX nr result
ID: Paeonia25_contig00025493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025493 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB87890.1| Serine/threonine-protein kinase ATM [Morus notabi... 39 8e-06 >gb|EXB87890.1| Serine/threonine-protein kinase ATM [Morus notabilis] Length = 3041 Score = 39.3 bits (90), Expect(2) = 8e-06 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = -1 Query: 235 KKVTLRFVKNILFNLCEHPYWSSYAKLTDMV 143 K+ + + IL+NLC+HPYWSS + TD++ Sbjct: 899 KECNSKVRERILYNLCQHPYWSSSSNFTDLI 929 Score = 35.8 bits (81), Expect(2) = 8e-06 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = -3 Query: 302 LFSSFFLDLPVVTWEILFDLLEKESDPEV 216 L S FF L VVTW+ILF+L++KE + +V Sbjct: 877 LISGFFSVLHVVTWDILFELMDKECNSKV 905