BLASTX nr result
ID: Paeonia25_contig00025438
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025438 (411 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ60165.1| hypothetical protein GLOTRDRAFT_112899 [Gloeophyl... 62 1e-07 >gb|EPQ60165.1| hypothetical protein GLOTRDRAFT_112899 [Gloeophyllum trabeum ATCC 11539] Length = 83 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +2 Query: 128 WCMISSCLGKPILASISDVWNLFVLSARSGR-GMQHRNRFGPGDGSEMWEMEYR 286 WC++SSC+GKP+L S+VW V AR GR G + R G DG EMWEMEYR Sbjct: 27 WCILSSCMGKPVLDFFSEVWRAAVSPARDGREGYRPMRRTGRADG-EMWEMEYR 79