BLASTX nr result
ID: Paeonia25_contig00025432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025432 (911 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ54675.1| hypothetical protein GLOTRDRAFT_139203 [Gloeophyl... 59 3e-06 >gb|EPQ54675.1| hypothetical protein GLOTRDRAFT_139203 [Gloeophyllum trabeum ATCC 11539] Length = 193 Score = 58.5 bits (140), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 226 KKPGMGERIMGDVEKAAGKVTGNHGMVQRGEERKLGEQY 110 KKPG G+++MG +EK AGK T N GMV+RGE+RK GE Y Sbjct: 155 KKPGFGDKLMGGLEKVAGKTTRNPGMVERGEDRKTGENY 193