BLASTX nr result
ID: Paeonia25_contig00025013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00025013 (1643 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCM03808.1| predicted protein [Fibroporia radiculosa] 59 5e-06 >emb|CCM03808.1| predicted protein [Fibroporia radiculosa] Length = 400 Score = 59.3 bits (142), Expect = 5e-06 Identities = 35/86 (40%), Positives = 48/86 (55%), Gaps = 2/86 (2%) Frame = +2 Query: 98 VPQEIWDATIDQLTDDHEALKETSLTCRSWHSRSRKHLFYKILVEDDPARRRYEKLVKAS 277 +PQE+ D ID L DD +L SLTC +W SR HLF + ++ A R+++L+K S Sbjct: 5 LPQELVDQVIDHLWDDFVSLAACSLTCHAWLPSSRTHLFRHVDLDSPSACFRFQQLLKTS 64 Query: 278 AKLAEI--STREDSKSLSPLLPAVQY 349 K+A R S SLS PA+ Y Sbjct: 65 PKIAPFVRKVRVRSYSLSQKPPALGY 90