BLASTX nr result
ID: Paeonia25_contig00023960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00023960 (965 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309517.1| hypothetical protein POPTR_0006s24910g [Popu... 69 3e-09 ref|XP_007227003.1| hypothetical protein PRUPE_ppa001581mg [Prun... 62 4e-07 >ref|XP_002309517.1| hypothetical protein POPTR_0006s24910g [Populus trichocarpa] gi|222855493|gb|EEE93040.1| hypothetical protein POPTR_0006s24910g [Populus trichocarpa] Length = 774 Score = 68.9 bits (167), Expect = 3e-09 Identities = 46/116 (39%), Positives = 64/116 (55%), Gaps = 4/116 (3%) Frame = +2 Query: 209 GKRRKIQNSKSHDTE--EVIKVE--RRSSRHDTNEDDLGIPHDEKLGKSRSSKHDSAGHG 376 G K+ S+ HD + + K + RR SR+D + E+ G+ R ++ D H Sbjct: 640 GDSSKLVRSRGHDDDVGDTRKEDEPRRGSRNDQE-------YKERGGEKRHAR-DEEDHR 691 Query: 377 GRKHNRDEEEYGYGGRHLEEEEGQQRGSRTHKSGEEEEQGSRRHERDGQMGAFKRA 544 GR++ RDEEE RH + E Q+ GSR H GE+EEQGSR HERD Q+ KR+ Sbjct: 692 GRRYQRDEEEDHDYRRHGKNEVDQRYGSRRHGRGEKEEQGSRGHERDKQIDHSKRS 747 >ref|XP_007227003.1| hypothetical protein PRUPE_ppa001581mg [Prunus persica] gi|462423939|gb|EMJ28202.1| hypothetical protein PRUPE_ppa001581mg [Prunus persica] Length = 799 Score = 61.6 bits (148), Expect = 4e-07 Identities = 38/109 (34%), Positives = 54/109 (49%), Gaps = 14/109 (12%) Frame = +2 Query: 221 KIQNSKSHDTEEVIKVERRSSRHDTNEDDLGIPHD-----EKLGKSRSSKHDSAGHGGRK 385 K + S DT++ + VER H + + + E+ G RS D H GRK Sbjct: 451 KSRGSGRIDTDDDVTVEREDRVHSKDSEPQWVSRRGNQDYEERGGGRSRSKDDQEHKGRK 510 Query: 386 HNRDEEEYGYGGRHLEEEE--GQQRGS-------RTHKSGEEEEQGSRR 505 H RDEE++G GRH +EEE G++ G R H+ EEE G+R+ Sbjct: 511 HGRDEEDHGIRGRHNKEEENRGRKHGRDEEDHEYRKHRENHEEEHGNRK 559