BLASTX nr result
ID: Paeonia25_contig00021913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00021913 (861 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34731.1| hypothetical protein CERSUDRAFT_54531 [Ceriporiop... 60 8e-07 >gb|EMD34731.1| hypothetical protein CERSUDRAFT_54531 [Ceriporiopsis subvermispora B] Length = 997 Score = 60.5 bits (145), Expect = 8e-07 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 727 VCPKLLSTGSCRDSSCTYEHSARYCKQCGIVCRSAHVFETHIHGR 861 VCP LSTGSC D++C +H CK CGIVC +A V+E H+ G+ Sbjct: 6 VCPTFLSTGSCPDTTCRLKHDIILCKLCGIVCTNARVYEIHLRGK 50