BLASTX nr result
ID: Paeonia25_contig00021294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00021294 (498 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007391540.1| hypothetical protein PHACADRAFT_249086 [Phan... 59 7e-07 ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Posti... 55 8e-06 >ref|XP_007391540.1| hypothetical protein PHACADRAFT_249086 [Phanerochaete carnosa HHB-10118-sp] gi|409049477|gb|EKM58954.1| hypothetical protein PHACADRAFT_249086 [Phanerochaete carnosa HHB-10118-sp] Length = 160 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/49 (61%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 352 MAFSR-FLSIIALSCLFVLANAENHTVTFVNNCGFGTPILQAENGAILS 495 MA+SR F +++A + +F NAE+HTVTFVNNCGFGTP+L+A NG LS Sbjct: 1 MAYSRIFTALVASAIVFAGVNAESHTVTFVNNCGFGTPLLKA-NGQTLS 48 >ref|XP_002473877.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] gi|220726977|gb|EED80910.1| hypothetical protein POSPLDRAFT_95888 [Postia placenta Mad-698-R] Length = 131 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = +1 Query: 379 IALSCLFVLANAENHTVTFVNNCGFGTPILQAENGAILS 495 +A++ FV NAE+HTVTF N CG+GTP L+A NGA+LS Sbjct: 10 LAVALAFVQVNAESHTVTFNNRCGYGTPYLRASNGAVLS 48